Property Summary

NCBI Gene PubMed Count 16
Grant Count 22
R01 Count 15
Funding $4,098,122.83
PubMed Score 106.19
PubTator Score 34.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 0.019
osteosarcoma -1.290 0.000
ovarian cancer -1.800 0.000

Gene RIF (3)

PMID Text
26056309 data suggest a model in which the 14-3-3 protein mediates SAC1 traffic from the ER through direct interaction with a sorting signal and COPII
18480408 Sac1 executes an essential household function in mammals that involves organization of both Golgi membranes and mitotic spindles
14527956 the enzymatic function of hSAC1 provides a switch for accessibility of the COPI interaction motif

AA Sequence

MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGN      1 - 70
YLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHVLNVDGFYFSTTYDLT     71 - 140
HTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWIL    141 - 210
ISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISK    211 - 280
VANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWD    281 - 350
RLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV    351 - 420
GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGF    421 - 490
RQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLLMAGDTWTETLAYVLFWGVAS    491 - 560
IGTFFIILYNGKDFVDAPRLVQKEKID                                               561 - 587
//

Text Mined References (23)

PMID Year Title
26056309 2015 Phosphoregulatory protein 14-3-3 facilitates SAC1 transport from the endoplasmic reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209621 2013 A four-step cycle driven by PI(4)P hydrolysis directs sterol/PI(4)P exchange by the ER-Golgi tether OSBP.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18480408 2008 The Sac1 phosphoinositide phosphatase regulates Golgi membrane morphology and mitotic spindle organization in mammals.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...