Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.011 0.003
posterior fossa group A ependymoma -1.400 0.000
cystic fibrosis -1.365 0.001
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell 1.100 0.001
diabetes mellitus 1.900 0.001
group 3 medulloblastoma -1.500 0.001
ovarian cancer 1.200 0.000

Gene RIF (2)

PMID Text
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19047128 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGGPVPGSPEGP      1 - 70
RTQCEHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDD     71 - 140
WTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALTANI    141 - 210
FKKFLRSVRPDRDRLLKEKPGWVTPMVPESRTGRSQKVKKRSLSKGSGHFPFPGTGEHRRGENPPTSCPK    211 - 280
ALEHSPSGFDINTAVWV                                                         281 - 297
//

Text Mined References (8)

PMID Year Title
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.