Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.6e-06
cystic fibrosis -1.280 4.1e-05
diabetes mellitus 1.900 1.3e-03
ependymoma -1.100 4.2e-05
group 3 medulloblastoma -1.500 5.2e-04
medulloblastoma, large-cell 1.100 6.8e-04
osteosarcoma 1.011 2.5e-03
ovarian cancer 1.200 2.6e-09

Synonym

Accession Q9NTI7 B3KP38 B4DF94 Q9NTI6
Symbols INKA2
C1orf183

Gene

Gene RIF (2)

AA Sequence

MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGGPVPGSPEGP      1 - 70
RTQCEHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDD     71 - 140
WTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALTANI    141 - 210
FKKFLRSVRPDRDRLLKEKPGWVTPMVPESRTGRSQKVKKRSLSKGSGHFPFPGTGEHRRGENPPTSCPK    211 - 280
ALEHSPSGFDINTAVWV                                                         281 - 297
//

Text Mined References (11)

PMID Year Title