Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.10
PubTator Score 119.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Dysequilibrium syndrome 4 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.8

Expression

  Differential Expression (16)

Disease log2 FC p
lung cancer -1.200 1.3e-02
adult high grade glioma -3.500 8.1e-09
astrocytic glioma -2.500 1.7e-03
Astrocytoma, Pilocytic -2.000 1.1e-05
atypical teratoid / rhabdoid tumor -3.400 2.0e-07
ependymoma -3.100 1.3e-03
glioblastoma -3.500 5.1e-12
group 3 medulloblastoma -1.500 1.1e-02
lung adenocarcinoma -1.500 6.4e-06
lung carcinoma 6.200 4.8e-78
medulloblastoma, large-cell -3.000 1.6e-03
non-small cell lung cancer -1.208 5.5e-08
oligodendroglioma -1.900 2.3e-02
osteosarcoma 1.484 5.4e-03
primitive neuroectodermal tumor -2.400 5.3e-04
psoriasis -1.300 2.9e-02

Gene RIF (4)

AA Sequence

MSRATSVGDQLEAPARTIYLNQPHLNKFRDNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIP      1 - 70
DVSPTGRYTTLVPLIIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVN     71 - 140
GQYLPADVVLLSSSEPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIECEGPNRHLYDF    141 - 210
TGNLNLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVL    211 - 280
FGILLVMALVSSAGALYWNRSHGEKNWYIKKMDTTSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQA    281 - 350
LFINWDTDMYYIGNDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREP    351 - 420
SSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAA    421 - 490
LVKGAKKLGFVFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGADNVIFE    491 - 560
RLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRLEECYEIIEKN    561 - 630
LLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATR    631 - 700
AAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKK    701 - 770
RVKAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCIL    771 - 840
YCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKIT    841 - 910
QNGEGFNTKVFWGHCINALVHSLILFWFPMKALEHDTVLTSGHATDYLFVGNIVYTYVVVTVCLKAGLET    911 - 980
TAWTKFSHLAVWGSMLTWLVFFGIYSTIWPTIPIAPDMRGQATMVLSSAHFWLGLFLVPTACLIEDVAWR    981 - 1050
AAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYA   1051 - 1120
FSQEEHGAVSQEEVIRAYDTTKKKSRKK                                             1121 - 1148
//

Text Mined References (17)

PMID Year Title