Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.300 0.015
sonic hedgehog group medulloblastoma 1.900 0.000
pediatric high grade glioma 1.100 0.004
pilocytic astrocytoma 1.600 0.000
Breast cancer -1.100 0.000
psoriasis -2.400 0.000

Gene RIF (3)

PMID Text
22334695 characterization of the expression and biochemical properties of EMILIN-3
18158787 Might play important roles in carcinogenesis of esophageal cancer.
14706625 EMILIN-5 gene plays an important role in skeletal development(EMILIN-5)

AA Sequence

MGRRRLLVWLCAVAALLSGAQARGTPLLARPAPPGASRYSLYTTGWRPRLRPGPHKALCAYVVHRNVTCI      1 - 70
LQEGAESYVKAEYRQCRWGPKCPGTVTYRTVLRPKYKVGYKTVTDLAWRCCPGFTGKRCPEHLTDHGAAS     71 - 140
PQLEPEPQIPSGQLDPGPRPPSYSRAAPSPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDP    141 - 210
NRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQTKVQLLDKVHGLALGHE    211 - 280
AHLQRLREAPPSPLTSLALLEEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRR    281 - 350
LHQSLDGRELALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDGLERALQAVTETQRGPGAPAGDEL    351 - 420
TRLSAAMLEGGVDGLLEGLETLNGTEGGARGCCLRLDMGGWGVGGFGTMLEERVQSLEERLATLAGELSH    421 - 490
DSASPGRSARPLVQTELAVLEQRLVSLETSCTPSTTSAILDSLVAEVKAWQSRSEALLRQVASHAALLQQ    491 - 560
LNGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFLAANTSLDERERKVEAEV    561 - 630
QAIQEQVSSQGSRLQAGHRQVLNLRGELEQLKAGVAKVASGLSRCQDTAQKLQHTVGHFDQRVAQVEGAC    631 - 700
RRLGLLAAGLDSLPTEPLRPREGLWSHVDQLNRTLAQHTQDIARLRDDLLDCQAQLAEQVRPGQAN        701 - 766
//

Text Mined References (9)

PMID Year Title
22334695 2012 EMILIN-3, peculiar member of elastin microfibril interface-located protein (EMILIN) family, has distinct expression pattern, forms oligomeric assemblies, and serves as transforming growth factor ? (TGF-?) antagonist.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
18158787 2007 Preparation and characterization of a novel monoclonal antibody specific to human EMILIN-5 protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706625 2004 Molecular cloning and characterization of a novel gene, EMILIN-5, and its possible involvement in skeletal development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221002 2002 Developmental expression and biochemical characterization of Emu family members.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.