Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.2e-61
Breast cancer 3578 9.1e-07
Astrocytoma, Pilocytic 3081 2.2e-04
pediatric high grade glioma 1064 4.1e-03
glioblastoma 5792 1.5e-02
medulloblastoma 720 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 2.2e-04
Breast cancer -1.100 9.1e-07
glioblastoma 1.300 1.5e-02
medulloblastoma 1.100 2.7e-02
pediatric high grade glioma 1.100 4.1e-03
psoriasis -2.400 1.2e-61

Gene RIF (3)

AA Sequence

MGRRRLLVWLCAVAALLSGAQARGTPLLARPAPPGASRYSLYTTGWRPRLRPGPHKALCAYVVHRNVTCI      1 - 70
LQEGAESYVKAEYRQCRWGPKCPGTVTYRTVLRPKYKVGYKTVTDLAWRCCPGFTGKRCPEHLTDHGAAS     71 - 140
PQLEPEPQIPSGQLDPGPRPPSYSRAAPSPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDP    141 - 210
NRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQTKVQLLDKVHGLALGHE    211 - 280
AHLQRLREAPPSPLTSLALLEEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRR    281 - 350
LHQSLDGRELALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDGLERALQAVTETQRGPGAPAGDEL    351 - 420
TRLSAAMLEGGVDGLLEGLETLNGTEGGARGCCLRLDMGGWGVGGFGTMLEERVQSLEERLATLAGELSH    421 - 490
DSASPGRSARPLVQTELAVLEQRLVSLETSCTPSTTSAILDSLVAEVKAWQSRSEALLRQVASHAALLQQ    491 - 560
LNGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFLAANTSLDERERKVEAEV    561 - 630
QAIQEQVSSQGSRLQAGHRQVLNLRGELEQLKAGVAKVASGLSRCQDTAQKLQHTVGHFDQRVAQVEGAC    631 - 700
RRLGLLAAGLDSLPTEPLRPREGLWSHVDQLNRTLAQHTQDIARLRDDLLDCQAQLAEQVRPGQAN        701 - 766
//

Text Mined References (9)

PMID Year Title