Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.17276540699077E-61
Breast cancer 3099 9.08875041447666E-7
sonic hedgehog group medulloblastoma 1482 2.27141820417256E-6
pilocytic astrocytoma 3086 1.66833664543537E-4
pediatric high grade glioma 2712 0.00406422316931572
glioblastoma 5572 0.0149642172834015

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.300 0.015
sonic hedgehog group medulloblastoma 1.900 0.000
pediatric high grade glioma 1.100 0.004
pilocytic astrocytoma 1.600 0.000
Breast cancer -1.100 0.000
psoriasis -2.400 0.000

Synonym

Accession Q9NT22 Q495S5 Q495S6 Q495S7 Q76KT4
Symbols EMILIN5
C20orf130
dJ620E11.4

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (3)

PMID Text
22334695 characterization of the expression and biochemical properties of EMILIN-3
18158787 Might play important roles in carcinogenesis of esophageal cancer.
14706625 EMILIN-5 gene plays an important role in skeletal development(EMILIN-5)

AA Sequence

MGRRRLLVWLCAVAALLSGAQARGTPLLARPAPPGASRYSLYTTGWRPRLRPGPHKALCAYVVHRNVTCI      1 - 70
LQEGAESYVKAEYRQCRWGPKCPGTVTYRTVLRPKYKVGYKTVTDLAWRCCPGFTGKRCPEHLTDHGAAS     71 - 140
PQLEPEPQIPSGQLDPGPRPPSYSRAAPSPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDP    141 - 210
NRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQTKVQLLDKVHGLALGHE    211 - 280
AHLQRLREAPPSPLTSLALLEEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRR    281 - 350
LHQSLDGRELALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDGLERALQAVTETQRGPGAPAGDEL    351 - 420
TRLSAAMLEGGVDGLLEGLETLNGTEGGARGCCLRLDMGGWGVGGFGTMLEERVQSLEERLATLAGELSH    421 - 490
DSASPGRSARPLVQTELAVLEQRLVSLETSCTPSTTSAILDSLVAEVKAWQSRSEALLRQVASHAALLQQ    491 - 560
LNGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFLAANTSLDERERKVEAEV    561 - 630
QAIQEQVSSQGSRLQAGHRQVLNLRGELEQLKAGVAKVASGLSRCQDTAQKLQHTVGHFDQRVAQVEGAC    631 - 700
RRLGLLAAGLDSLPTEPLRPREGLWSHVDQLNRTLAQHTQDIARLRDDLLDCQAQLAEQVRPGQAN        701 - 766
//

Text Mined References (9)

PMID Year Title
22334695 2012 EMILIN-3, peculiar member of elastin microfibril interface-located protein (EMILIN) family, has distinct expression pattern, forms oligomeric assemblies, and serves as transforming growth factor ? (TGF-?) antagonist.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
18158787 2007 Preparation and characterization of a novel monoclonal antibody specific to human EMILIN-5 protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706625 2004 Molecular cloning and characterization of a novel gene, EMILIN-5, and its possible involvement in skeletal development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221002 2002 Developmental expression and biochemical characterization of Emu family members.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.