Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.12
PubTator Score 7.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.75404055959371E-9
malignant mesothelioma 3163 2.61253853455661E-9
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00373023083011549

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -4.300 0.000
osteosarcoma -2.439 0.000
pancreatic ductal adenocarcinoma liver m... -1.185 0.004

Synonym

Accession Q9NSY2 P59094
Symbols

Gene

PANTHER Protein Class (1)

PDB

2R55  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (8)

PMID Text
24440759 Studies show the 3 steroidogenic acute regulatory-related lipid transfer (START) domain proteins StarD4, StarD5 and StarD6 have a similar lipid binding pocket specific for sterols (cholesterol in particular), but differing regulation and localization.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19474188 Data support STARD5 functioning in kidney, specifically within proximal tubule cells, and suggest a role in ER-associated cholesterol transport.
16534142 The presence of StarD5 different human liver cells that are related to inflammatory processes provides new clues to its role of in free sterol transport in the cells and in lipid-mediated atherogenesis.
15897605 demonstrated StarD5 protein in liver cytosolic fractions only, suggesting StarD5 as a directional cytosolic sterol carrier
15760897 StarD4 is regulated by sterols via SREBP-2, and StarD5 is activated by ER stress cholesterol metabolism; they serve different functions

AA Sequence

MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP      1 - 70
AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP     71 - 140
LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ    141 - 210
FHE                                                                       211 - 213
//

Text Mined References (20)

PMID Year Title
24440759 2014 The StarD4 subfamily of steroidogenic acute regulatory-related lipid transfer (START) domain proteins: new players in cholesterol metabolism.
23872533 2013 Thermodynamic and solution state NMR characterization of the binding of secondary and conjugated bile acids to STARD5.
21738568 2011 Comparative structural analysis of lipid binding START domains.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19474188 2009 Steroidogenic acute regulatory-related lipid transfer domain protein 5 localization and regulation in renal tubules.
18403318 2008 Intracellular cholesterol transporter StarD4 binds free cholesterol and increases cholesteryl ester formation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16534142 2006 Localization of StarD5 cholesterol binding protein.
More...