Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.50
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 5.2e-04
Astrocytoma, Pilocytic 1.100 6.3e-05
glioblastoma 1.700 3.7e-07
group 3 medulloblastoma 2.500 1.5e-05
invasive ductal carcinoma 1.300 1.1e-04
lung cancer 1.400 3.5e-02
malignant mesothelioma 1.400 9.8e-07
non-small cell lung cancer 1.573 1.1e-21
osteosarcoma -2.087 2.4e-03
posterior fossa group A ependymoma 1.200 8.2e-06
primitive neuroectodermal tumor 1.500 5.3e-04
psoriasis -2.400 8.4e-05

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MFLPHMNHLTLEQTFFSQVLPKTVKLFDDMMYELTSQARGLSSQNLEIQTTLRNILQTMVQLLGALTGCV      1 - 70
QHICATQESIILENIQSLPSSVLHIIKSTFVHCKNSESVYSGCLHLVSDLLQALFKEAYSLQKQLMELLD     71 - 140
MVCMDPLVDDNDDILNMVIVIHSLLDICSVISSMDHAFHANTWKFIIKQSLKHQSIIKSQLKHKDIITSL    141 - 210
CEDILFSFHSCLQLAEQMTQSDAQDNADYRLFQKTLKLCRFFANSLLHYAKEFLPFLSDSCCTLHQLYLQ    211 - 280
IHSKFPPSLYATRISKAHQEEIAGAFLVTLDPLISQLLTFQPFMQVVLDSKLDLPCELQFPQCLLLVVVM    281 - 350
DKLPSQPKEVQTLWCTDSQVSETTTRISLLKAVFYSFEQCSGELSLPVHLQGLKSKGKAEVAVTLYQHVC    351 - 420
VHLCTFITSFHPSLFAELDAALLNAVLSANMITSLLAMDAWCFLARYGTAELCAHHVTIVAHLIKSCPGE    421 - 490
CYQLINLSILLKRLFFFMAPPHQLEFIQKFSPKEAENLPLWQHISFQALPPELREQTVHEVTTVGTAECR    491 - 560
KWLSRSRTLGELESLNTVLSALLAVCNSAGEALDTGKQTAIIEVVSQLWAFLNIKQVADQPYVQQTFSLL    561 - 630
LPLLGFFIQTLDPKLILQAVTLQTSLLKLELPDYVRLAMLDFVSSLGKLFIPEAIQDRILPNLSCMFALL    631 - 700
LADRSWLLEQHTLEAFTQFAEGTNHEEIVPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERVKQEKGIF    701 - 770
WEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEYRSALHTIAGALEATESLLQKGPAPAWLSMEMEALQE    771 - 840
RMDKLKRYIHTLG                                                             841 - 853
//

Text Mined References (13)

PMID Year Title