Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -4.825 0.000
active Crohn's disease -1.401 0.032
Breast cancer 1.400 0.019
ovarian cancer -2.700 0.000

Gene RIF (1)

PMID Text
12445816 These results suggest that the expression of human ABCC13 is related with hematopoiesis.

AA Sequence

MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTA      1 - 70
CPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMK     71 - 140
QIIIFCEHSSDFGWNGYGYAVALLVVVFLQTLILQQYQRFNMLTSAKVKTAVNGLIYKKALLLSNVSRQK    141 - 210
FSTGEIINLMSATHGLDSKPQSPLVCPFSNPNGRISPLARAGSSSVSRGGSPCVCYTNKCFSCN          211 - 274
//

Text Mined References (12)

PMID Year Title
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
18668432 2008 MRP class of human ATP binding cassette (ABC) transporters: historical background and new research directions.
16124856 2005 Evolution of the ATP-binding cassette (ABC) transporter superfamily in vertebrates.
15203202 2004 Degeneration of an ATP-binding cassette transporter gene, ABCC13, in different mammalian lineages.
14759258 2004 An unappreciated role for RNA surveillance.
12909339 2003 Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445816 2002 ABCC13, an unusual truncated ABC transporter, is highly expressed in fetal human liver.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
10830953 2000 The DNA sequence of human chromosome 21.
More...