Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
osteosarcoma 7933 2.2e-10
ovarian cancer 8491 6.5e-07
Breast cancer 3098 1.9e-02
active Crohn's disease 918 3.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -4.825 2.2e-10
active Crohn's disease -1.401 3.2e-02
Breast cancer 1.400 1.9e-02
ovarian cancer -2.700 6.5e-07

Gene RIF (1)

PMID Text
12445816 These results suggest that the expression of human ABCC13 is related with hematopoiesis.

AA Sequence

MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTA      1 - 70
CPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMK     71 - 140
QIIIFCEHSSDFGWNGYGYAVALLVVVFLQTLILQQYQRFNMLTSAKVKTAVNGLIYKKALLLSNVSRQK    141 - 210
FSTGEIINLMSATHGLDSKPQSPLVCPFSNPNGRISPLARAGSSSVSRGGSPCVCYTNKCFSCN          211 - 274
//

Text Mined References (12)

PMID Year Title
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
18668432 2008 MRP class of human ATP binding cassette (ABC) transporters: historical background and new research directions.
16124856 2005 Evolution of the ATP-binding cassette (ABC) transporter superfamily in vertebrates.
15203202 2004 Degeneration of an ATP-binding cassette transporter gene, ABCC13, in different mammalian lineages.
14759258 2004 An unappreciated role for RNA surveillance.
12909339 2003 Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445816 2002 ABCC13, an unusual truncated ABC transporter, is highly expressed in fetal human liver.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
10830953 2000 The DNA sequence of human chromosome 21.
10049586 1999 Molecular cloning of mouse Lrp7(Lr3) cDNA and chromosomal mapping of orthologous genes in mouse and human.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.