Property Summary

NCBI Gene PubMed Count 12
PubMed Score 83.02
PubTator Score 8.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Leigh disease 100 3.215 1.6
Disease Target Count
Leigh syndrome 28

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 3.000 4.0e-02
intraductal papillary-mucinous adenoma (... 1.300 4.1e-03
intraductal papillary-mucinous carcinoma... 1.200 3.1e-03
lung cancer 1.500 7.2e-05
Multiple myeloma 1.529 4.6e-03
ovarian cancer 2.100 3.3e-04

Gene RIF (6)

AA Sequence

MRWGLRPRGPGAAALATARSLWGTPRLPCSPGWQGATKRLLVRSVSGASNHQPNSNSGRYRDTVLLPQTS      1 - 70
FPMKLLGRQQPDTELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANGDPHVGHALNKILKDIANRFH     71 - 140
MMNGSKIHFVPGWDCHGLPIEIKVLSELGREAQNLSAMEIRKKARSFAKAAIEKQKSAFIRWGIMADWNN    141 - 210
CYYTFDGKYEAKQLRTFYQMYDKGLVYRSYKPVFWSPSSRTALAEAELEYNPEHVSRSIYVKFPLLKPSP    211 - 280
KLASLIDGSSPVSILVWTTQPWTIPANEAVCYMPESKYAVVKCSKSGDLYVLAADKVASVASTLETTFET    281 - 350
ISTLSGVDLENGTCSHPLIPDKASPLLPANHVTMAKGTGLVHTAPAHGMEDYGVASQHNLPMDCLVDEDG    351 - 420
VFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQWFINITDIKT    421 - 490
AAKELLKKVKFIPGSALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQH    491 - 560
GSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQDILDIWFDSGTSWSYVLPGPDQRADLYLEGKDQLGG    561 - 630
WFQSSLLTSVAARKRAPYKTVIVHGFTLGEKGEKMSKSLGNVIHPDVVVNGGQDQSKEPPYGADVLRWWV    631 - 700
ADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKI    701 - 770
TELYKQYDFGKVVRLLRTFYTRELSNFYFSIIKDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPH    771 - 840
LAEEVFQHIPYIKEPKSVFRTGWISTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAEYKVITVIEPG    841 - 910
LLFEIIEMLQSEETSSTSQLNELMMASESTLLAQEPREMTADVIELKGKFLINLEGGDIREESSYKVIVM    911 - 980
PTTKEKCPRCWKYTAESSDTLCPRCAEVVSGK                                          981 - 1012
//

Text Mined References (16)

PMID Year Title