Property Summary

NCBI Gene PubMed Count 11
PubMed Score 85.72
PubTator Score 8.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.529 0.005
intraductal papillary-mucinous adenoma (... 1.300 0.004
intraductal papillary-mucinous carcinoma... 1.200 0.003
lung cancer 1.500 0.000
Breast cancer 3.000 0.040
ovarian cancer 2.100 0.000

Synonym

Accession Q9NSE4 B2RPG8 Q1M2P9 Q6PI85 Q7L439 Q86WU9 Q96D91 Q9H9Q8 Q9NW42
Symbols ILERS
CAGSSS

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26722399 The expression of IARS2 gene is different in human colon cancer and surrounding tissues. IARS2 gene is probably a cancer-promoting gene
25130867 This study is the first report of clinical findings associated with IARS2 mutations.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MRWGLRPRGPGAAALATARSLWGTPRLPCSPGWQGATKRLLVRSVSGASNHQPNSNSGRYRDTVLLPQTS      1 - 70
FPMKLLGRQQPDTELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANGDPHVGHALNKILKDIANRFH     71 - 140
MMNGSKIHFVPGWDCHGLPIEIKVLSELGREAQNLSAMEIRKKARSFAKAAIEKQKSAFIRWGIMADWNN    141 - 210
CYYTFDGKYEAKQLRTFYQMYDKGLVYRSYKPVFWSPSSRTALAEAELEYNPEHVSRSIYVKFPLLKPSP    211 - 280
KLASLIDGSSPVSILVWTTQPWTIPANEAVCYMPESKYAVVKCSKSGDLYVLAADKVASVASTLETTFET    281 - 350
ISTLSGVDLENGTCSHPLIPDKASPLLPANHVTMAKGTGLVHTAPAHGMEDYGVASQHNLPMDCLVDEDG    351 - 420
VFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQWFINITDIKT    421 - 490
AAKELLKKVKFIPGSALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQH    491 - 560
GSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQDILDIWFDSGTSWSYVLPGPDQRADLYLEGKDQLGG    561 - 630
WFQSSLLTSVAARKRAPYKTVIVHGFTLGEKGEKMSKSLGNVIHPDVVVNGGQDQSKEPPYGADVLRWWV    631 - 700
ADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKI    701 - 770
TELYKQYDFGKVVRLLRTFYTRELSNFYFSIIKDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPH    771 - 840
LAEEVFQHIPYIKEPKSVFRTGWISTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAEYKVITVIEPG    841 - 910
LLFEIIEMLQSEETSSTSQLNELMMASESTLLAQEPREMTADVIELKGKFLINLEGGDIREESSYKVIVM    911 - 980
PTTKEKCPRCWKYTAESSDTLCPRCAEVVSGK                                          981 - 1012
//

Text Mined References (15)

PMID Year Title
26722399 2015 Expression of IARS2 gene in colon cancer and effect of its knockdown on biological behavior of RKO cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25130867 2014 Mutation in the nuclear-encoded mitochondrial isoleucyl-tRNA synthetase IARS2 in patients with cataracts, growth hormone deficiency with short stature, partial sensorineural deafness, and peripheral neuropathy or with Leigh syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19209188 2009 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...