Property Summary

NCBI Gene PubMed Count 24
Grant Count 46
R01 Count 28
Funding $4,199,700.43
PubMed Score 42.63
PubTator Score 88.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25816005 These data provide compelling evidence that HOMER2 is required for normal hearing and that its sequence alteration in humans leads to ADNSHL through a dominant-negative mode of action
25649652 This study showed that HOMER2 (rs1256429; intronic, p = 8.7 x 10(1)) associated with Alzheimer disease.
21885651 monitored Homer1 and Homer2 expression and subcellular localization in skeletal muscle biopsies following 60 days of bedrest
20333726 Haplotypes of the HOMER 1 and 2 genes are unlikely to play a major role in the pathophysiology of alcohol dependence.
20333726 Observational study of gene-disease association. (HuGE Navigator)
19914345 This study supports a role for HOMER2 gene in schizophrenia susceptibility.
19914345 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
16314758 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ     71 - 140
ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ    141 - 210
WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL    211 - 280
MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL    281 - 350
GTDN                                                                      351 - 354
//

Text Mined References (25)

PMID Year Title
25816005 2015 HOMER2, a stereociliary scaffolding protein, is essential for normal hearing in humans and mice.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25416956 2014 A proteome-scale map of the human interactome network.
21885651 2011 Expression and regulation of Homer in human skeletal muscle during neuromuscular junction adaptation to disuse and exercise.
21636702 2011 Novel candidate colorectal cancer biomarkers identified by methylation microarray-based scanning.
20921022 2010 Recurrent microdeletions of 15q25.2 are associated with increased risk of congenital diaphragmatic hernia, cognitive deficits and possibly Diamond--Blackfan anaemia.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
20333726 2010 No association of alcohol dependence with HOMER 1 and 2 genetic variants.
19914345 2010 Replicated genetic evidence supports a role for HOMER2 in schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...