Property Summary

NCBI Gene PubMed Count 24
PubMed Score 42.63
PubTator Score 88.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Cocaine-Related Disorders 88
Disease Target Count P-value
Breast cancer 3099 3.42008344356783E-15
pilocytic astrocytoma 3086 2.44658390500989E-8
glioblastoma 5572 2.72181963440132E-6
acute quadriplegic myopathy 1157 3.58058310796554E-6
ovarian cancer 8492 1.25839123759112E-5
cystic fibrosis 1670 1.92990408121064E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.38541570997066E-4
posterior fossa group A ependymoma 1511 2.95353169323666E-4
lung cancer 4473 4.16300563149379E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0010287610603488
adult high grade glioma 2148 0.00147761603123377
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00149649942981184
pancreatic cancer 2300 0.00388737256925828
primary pancreatic ductal adenocarcinoma 1271 0.0116689770423025
esophageal adenocarcinoma 737 0.0190553920760902
Endometriosis 535 0.0220750355788004
astrocytic glioma 2241 0.02358485689869
gastric carcinoma 832 0.0349140413056307
invasive ductal carcinoma 2950 0.0467677950289296
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count
Deafness, autosomal dominant, 68 1

Expression

Synonym

Accession Q9NSB8 O95269 O95349 Q9NSB6 Q9NSB7 Q9UNT7 Homer-2
Symbols CPD
ACPD
DFNA68
VESL-2
HOMER-2

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
25816005 These data provide compelling evidence that HOMER2 is required for normal hearing and that its sequence alteration in humans leads to ADNSHL through a dominant-negative mode of action
25649652 This study showed that HOMER2 (rs1256429; intronic, p = 8.7 x 10(1)) associated with Alzheimer disease.
21885651 monitored Homer1 and Homer2 expression and subcellular localization in skeletal muscle biopsies following 60 days of bedrest
20333726 Haplotypes of the HOMER 1 and 2 genes are unlikely to play a major role in the pathophysiology of alcohol dependence.
20333726 Observational study of gene-disease association. (HuGE Navigator)
19914345 This study supports a role for HOMER2 gene in schizophrenia susceptibility.
19914345 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
16314758 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ     71 - 140
ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ    141 - 210
WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL    211 - 280
MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL    281 - 350
GTDN                                                                      351 - 354
//

Text Mined References (25)

PMID Year Title
25816005 2015 HOMER2, a stereociliary scaffolding protein, is essential for normal hearing in humans and mice.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25416956 2014 A proteome-scale map of the human interactome network.
21885651 2011 Expression and regulation of Homer in human skeletal muscle during neuromuscular junction adaptation to disuse and exercise.
21636702 2011 Novel candidate colorectal cancer biomarkers identified by methylation microarray-based scanning.
20921022 2010 Recurrent microdeletions of 15q25.2 are associated with increased risk of congenital diaphragmatic hernia, cognitive deficits and possibly Diamond--Blackfan anaemia.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
20333726 2010 No association of alcohol dependence with HOMER 1 and 2 genetic variants.
19914345 2010 Replicated genetic evidence supports a role for HOMER2 in schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...