Property Summary

NCBI Gene PubMed Count 25
PubMed Score 45.50
PubTator Score 88.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy -1.363 3.6e-06
adult high grade glioma -1.600 1.5e-03
astrocytic glioma -1.200 2.4e-02
Astrocytoma, Pilocytic -2.400 1.5e-08
Breast cancer -2.400 3.4e-15
cystic fibrosis 1.329 1.9e-05
Endometriosis -1.245 2.2e-02
esophageal adenocarcinoma -1.300 1.9e-02
gastric carcinoma -1.900 2.8e-02
glioblastoma -1.500 2.7e-06
intraductal papillary-mucinous adenoma (... -1.900 1.0e-02
intraductal papillary-mucinous carcinoma... -3.500 1.4e-04
intraductal papillary-mucinous neoplasm ... -3.300 1.0e-03
invasive ductal carcinoma 1.400 4.7e-02
lung cancer 1.200 4.2e-03
ovarian cancer 1.600 1.3e-05
pancreatic cancer -1.600 6.1e-04
posterior fossa group A ependymoma -1.100 3.0e-04
primary pancreatic ductal adenocarcinoma -2.063 1.2e-02

Gene RIF (13)

AA Sequence

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ     71 - 140
ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ    141 - 210
WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL    211 - 280
MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL    281 - 350
GTDN                                                                      351 - 354
//

Text Mined References (26)

PMID Year Title