Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $57,250
PubMed Score 0.15
PubTator Score 56.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.001
adult high grade glioma 1.200 0.001
ovarian cancer 1.300 0.000
psoriasis -1.200 0.000

AA Sequence

MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASR      1 - 70
CGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRF     71 - 140
LEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEE    141 - 210
ELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNS    211 - 280
RELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQET    281 - 350
ENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY    351 - 420
RRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLL    421 - 490
SCGSGRKSSMTLGAGGSSPSHKH                                                   491 - 513
//

Text Mined References (6)

PMID Year Title
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
10692104 2000 Characterization of a 300 kbp region of human DNA containing the type II hair keratin gene domain.
2431943 1986 The complement of native alpha-keratin polypeptides of hair-forming cells: a subset of eight polypeptides that differ from epithelial cytokeratins.