Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.15
PubTator Score 56.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.5e-12
psoriasis 6694 6.4e-05
medulloblastoma, large-cell 6241 6.5e-04
adult high grade glioma 3801 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count
Monilethrix 18

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 1.3e-03
medulloblastoma, large-cell 1.200 6.5e-04
ovarian cancer 1.300 6.5e-12
psoriasis -1.200 6.4e-05

Synonym

Accession Q9NSB4
Symbols HB2
Hb-2
KRTHB2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASR      1 - 70
CGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRF     71 - 140
LEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEE    141 - 210
ELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNS    211 - 280
RELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQET    281 - 350
ENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY    351 - 420
RRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLL    421 - 490
SCGSGRKSSMTLGAGGSSPSHKH                                                   491 - 513
//

Text Mined References (6)

PMID Year Title