Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.04
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.08845033195005E-7
psoriasis 6685 1.36171025567427E-4
medulloblastoma 1524 2.13565973503026E-4
ovarian cancer 8492 9.27201383631721E-4
osteosarcoma 7933 0.00188824641898784
nasopharyngeal carcinoma 1056 0.00556948298317167
acute myeloid leukemia 785 0.022683500217018
Rheumatoid Arthritis 1171 0.0286710847722256

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.029
psoriasis -2.400 0.000
osteosarcoma -1.861 0.002
medulloblastoma -1.100 0.000
pilocytic astrocytoma 1.100 0.000
acute myeloid leukemia 1.100 0.023
nasopharyngeal carcinoma 1.300 0.006
ovarian cancer 1.500 0.001

Synonym

Accession Q9NS93 B3KMZ3 Q9NUS4
Symbols

Gene

  Ortholog (10)

Gene RIF (2)

PMID Text
21853325 Data indicate that TM7SF3 plays a role in inhibition of cytokine-induced cell death/apoptosis in pancreatic beta cells and in inhibition of insulin secretion from pancreatic beta cells.
20734064 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIH      1 - 70
SQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCN     71 - 140
LEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEM    141 - 210
LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFE    211 - 280
AGEGSCASLGRVSSKVFFTLFALLGFFICFFGHRFWKTELFFIGFIIMGFFFYILITRLTPIKYDVNLIL    281 - 350
TAVTGSVGGMFLVAVWWRFGILSICMLCVGLVLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIP    351 - 420
VVFMGCLRILNILTCGVIGSYSVVLAIDSYWSTSLSYITLNVLKRALNKDFHRAFTNVPFQTNDFIILAV    421 - 490
WGMLAVSGITLQIRRERGRPFFPPHPYKLWKQERERRVTNILDPSYHIPPLRERLYGRLTQIKGLFQKEQ    491 - 560
PAGERTPLLL                                                                561 - 570
//

Text Mined References (8)

PMID Year Title
21853325 2011 An siRNA screen identifies transmembrane 7 superfamily member 3 (TM7SF3), a seven transmembrane orphan receptor, as an inhibitor of cytokine-induced death of pancreatic beta cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828615 2000 Isolation and characterization of a novel gene encoding a putative seven-span transmembrane protein, TM7SF3.