Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.12
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.100 2.3e-02
Astrocytoma, Pilocytic 1.100 1.3e-07
group 4 medulloblastoma -1.100 1.2e-04
nasopharyngeal carcinoma 1.300 5.6e-03
osteosarcoma -1.861 1.9e-03
ovarian cancer 1.500 9.3e-04
psoriasis -2.400 1.4e-04
Rheumatoid arthritis 1.300 2.9e-02

Gene RIF (3)

AA Sequence

MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIH      1 - 70
SQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCN     71 - 140
LEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEM    141 - 210
LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFE    211 - 280
AGEGSCASLGRVSSKVFFTLFALLGFFICFFGHRFWKTELFFIGFIIMGFFFYILITRLTPIKYDVNLIL    281 - 350
TAVTGSVGGMFLVAVWWRFGILSICMLCVGLVLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIP    351 - 420
VVFMGCLRILNILTCGVIGSYSVVLAIDSYWSTSLSYITLNVLKRALNKDFHRAFTNVPFQTNDFIILAV    421 - 490
WGMLAVSGITLQIRRERGRPFFPPHPYKLWKQERERRVTNILDPSYHIPPLRERLYGRLTQIKGLFQKEQ    491 - 560
PAGERTPLLL                                                                561 - 570
//

Text Mined References (9)

PMID Year Title