Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.04
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.029
psoriasis -2.400 0.000
osteosarcoma -1.861 0.002
medulloblastoma -1.100 0.000
pilocytic astrocytoma 1.100 0.000
acute myeloid leukemia 1.100 0.023
nasopharyngeal carcinoma 1.300 0.006
ovarian cancer 1.500 0.001

Gene RIF (2)

PMID Text
21853325 Data indicate that TM7SF3 plays a role in inhibition of cytokine-induced cell death/apoptosis in pancreatic beta cells and in inhibition of insulin secretion from pancreatic beta cells.
20734064 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIH      1 - 70
SQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCN     71 - 140
LEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEM    141 - 210
LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFE    211 - 280
AGEGSCASLGRVSSKVFFTLFALLGFFICFFGHRFWKTELFFIGFIIMGFFFYILITRLTPIKYDVNLIL    281 - 350
TAVTGSVGGMFLVAVWWRFGILSICMLCVGLVLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIP    351 - 420
VVFMGCLRILNILTCGVIGSYSVVLAIDSYWSTSLSYITLNVLKRALNKDFHRAFTNVPFQTNDFIILAV    421 - 490
WGMLAVSGITLQIRRERGRPFFPPHPYKLWKQERERRVTNILDPSYHIPPLRERLYGRLTQIKGLFQKEQ    491 - 560
PAGERTPLLL                                                                561 - 570
//

Text Mined References (8)

PMID Year Title
21853325 2011 An siRNA screen identifies transmembrane 7 superfamily member 3 (TM7SF3), a seven transmembrane orphan receptor, as an inhibitor of cytokine-induced death of pancreatic beta cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828615 2000 Isolation and characterization of a novel gene encoding a putative seven-span transmembrane protein, TM7SF3.