Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.08
PubTator Score 2.56

Knowledge Summary

Patent (2,425)

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -3.000 1.5e-04
astrocytoma -1.100 3.5e-05
Breast cancer -1.100 2.5e-02
cystic fibrosis 2.100 1.2e-03
facioscapulohumeral dystrophy 2.400 3.8e-03
glioblastoma -1.500 2.9e-02
interstitial cystitis -2.600 8.4e-05
intraductal papillary-mucinous adenoma (... -2.500 2.2e-03
intraductal papillary-mucinous carcinoma... -3.100 5.7e-05
pituitary cancer 1.400 1.4e-04
tuberculosis 3.100 5.5e-05

AA Sequence

MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDLCLADGLRALA      1 - 70
CLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTRYLAIAHHRFYAERLAGWPCA     71 - 140
AMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVVVGATHLVYLRLLFFIHD    141 - 210
RRKMRPARLVPAVSHDWTFHGPGATGQAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEK    211 - 280
RLCKMFYAVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFR    281 - 350
AQFPCCQSPRTTQATHPCDLKGIGL                                                 351 - 375
//

Text Mined References (1)

PMID Year Title