Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.58
PubTator Score 2.56

Knowledge Summary

Patent (2,425)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
interstitial cystitis 2299 8.72017721096012E-6
astrocytoma 1493 3.52808377808965E-5
tuberculosis 1563 5.49149257814901E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.68039829202926E-5
pituitary cancer 1972 1.41228865929045E-4
adult high grade glioma 2148 1.47069528104976E-4
cystic fibrosis 1670 0.00119387057101438
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00224408387741798
glioblastoma 5572 0.00289388978117223
facioscapulohumeral dystrophy 286 0.0037818546077489
inflammatory breast cancer 404 0.0254471483857569
Disease Target Count Z-score Confidence
Blepharophimosis 17 3.913 2.0

Synonym

Accession Q9NS67
Symbols SREB1

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available, zebrafish phenotype observed
Steve Finkbeiner Neuron specific phenotypes being screened

AA Sequence

MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDLCLADGLRALA      1 - 70
CLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTRYLAIAHHRFYAERLAGWPCA     71 - 140
AMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVVVGATHLVYLRLLFFIHD    141 - 210
RRKMRPARLVPAVSHDWTFHGPGATGQAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEK    211 - 280
RLCKMFYAVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFR    281 - 350
AQFPCCQSPRTTQATHPCDLKGIGL                                                 351 - 375
//

Text Mined References (1)

PMID Year Title
10833454 2000 An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.