Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.73
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.493 1.5e-02
active ulcerative colitis 1.315 4.9e-02
astrocytic glioma -1.100 4.6e-02
atypical teratoid / rhabdoid tumor -1.200 1.5e-02
Breast cancer -1.100 7.4e-06
glioblastoma -1.600 3.4e-03
group 4 medulloblastoma -1.200 3.8e-04
intraductal papillary-mucinous adenoma (... -1.100 1.8e-02
lung cancer -1.100 1.4e-02
medulloblastoma, large-cell -1.400 1.1e-04
osteosarcoma -1.764 1.4e-04
ovarian cancer -2.000 3.4e-09
pediatric high grade glioma -1.400 4.8e-04
Pick disease -1.300 6.7e-04
psoriasis -1.600 3.7e-04
subependymal giant cell astrocytoma -1.034 1.6e-02
tuberculosis -1.300 2.9e-04

Gene RIF (1)

AA Sequence

MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSG      1 - 70
TECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTE     71 - 140
MVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKG    141 - 210
FAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQE    211 - 280
KDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASV    281 - 350
GVRWMIGVTEIDKGSAYGNSDSKQKLND                                              351 - 378
//

Text Mined References (14)

PMID Year Title