Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.73
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.40279034141221E-9
ulcerative colitis 2087 2.38920202516673E-6
osteosarcoma 7933 6.55000974276003E-6
Breast cancer 3099 7.38969887583195E-6
medulloblastoma, large-cell 6234 1.09222818567223E-5
Pick disease 1893 1.67597587073641E-5
tuberculosis and treatment for 3 months 327 4.3715725119428E-5
psoriasis 6685 3.74887275391128E-4
group 4 medulloblastoma 1875 3.79229102495353E-4
pediatric high grade glioma 2712 4.8288423371467E-4
active Crohn's disease 918 0.00143604773365635
glioblastoma 5572 0.00337223576129289
lung cancer 4473 0.0138836082470257
atypical teratoid / rhabdoid tumor 4369 0.0148740920493294
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0183275055532352
subependymal giant cell astrocytoma 2287 0.0265833383094407
astrocytic glioma 2241 0.0464723988497589

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.100 0.046
psoriasis -1.600 0.000
osteosarcoma -2.721 0.000
atypical teratoid / rhabdoid tumor -1.200 0.015
glioblastoma -1.600 0.003
medulloblastoma, large-cell -1.800 0.000
tuberculosis and treatment for 3 months -1.400 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.018
lung cancer -1.100 0.014
active Crohn's disease 1.852 0.001
ulcerative colitis 1.800 0.000
pediatric high grade glioma -1.400 0.000
group 4 medulloblastoma -1.200 0.000
subependymal giant cell astrocytoma -1.876 0.027
Pick disease -2.000 0.000
Breast cancer -1.100 0.000
ovarian cancer -2.000 0.000

Synonym

Accession Q9NRZ5 B4DSF9 Q5TEF0
Symbols 1-AGPAT4
dJ473J16.2
LPAAT-delta

Gene

  Ortholog (13)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSG      1 - 70
TECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTE     71 - 140
MVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKG    141 - 210
FAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQE    211 - 280
KDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASV    281 - 350
GVRWMIGVTEIDKGSAYGNSDSKQKLND                                              351 - 378
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
21173190 2011 Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367102 2005 Cloning and characterization of murine 1-acyl-sn-glycerol 3-phosphate acyltransferases and their regulation by PPARalpha in murine heart.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...