Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.41
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -2.600 0.000
astrocytoma -1.200 0.000
glioblastoma -3.000 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.301 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.800 0.001
non-small cell lung cancer 1.394 0.000
lung cancer 1.100 0.004
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -2.800 0.000
lung carcinoma 1.700 0.000
Pick disease -1.400 0.002
pituitary cancer 1.300 0.000

Synonym

Accession Q9NRW1 B2R5Z9 B7Z337 D3DND3 Q92929
Symbols

Gene

PDB

2E9S   2FE4   2FFQ  

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18044744 DYNLRB1 specifically interacts with all three Rab6 isoforms and co-localises at the Golgi.
17707369 The brain-specific Rab6B via Bicaudal-D1 is linked to the dynein/dynactin complex, suggesting a regulatory role for Rab6B in the retrograde transport of cargo in neuronal cells.
16790928 Conformational changes in human neuronal Rab6B between its inactive GDP and active GTP-like state are observed mainly in the switch I and switch II regions, confirming their role as a molecular switch.

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE     71 - 140
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC      141 - 208
//

Text Mined References (19)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18044744 2008 Rab6 family proteins interact with the dynein light chain protein DYNLRB1.
17707369 2007 A role for the Rab6B Bicaudal-D1 interaction in retrograde transport in neuronal cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...