Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.53
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-02
astrocytoma -1.200 3.1e-16
Astrocytoma, Pilocytic -2.800 1.5e-11
atypical teratoid / rhabdoid tumor -1.100 3.1e-03
ependymoma -2.000 2.8e-02
glioblastoma -2.400 9.4e-10
group 3 medulloblastoma -1.400 3.0e-03
lung cancer 1.100 3.6e-03
lung carcinoma 1.700 3.4e-29
medulloblastoma, large-cell -1.600 2.5e-04
non-small cell lung cancer 1.394 5.1e-07
oligodendroglioma -1.300 4.7e-13
osteosarcoma -2.132 6.3e-05
Pick disease -1.400 2.0e-03
pituitary cancer 1.200 1.8e-03
primitive neuroectodermal tumor -1.800 1.2e-03

Gene RIF (4)

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE     71 - 140
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC      141 - 208
//

Text Mined References (19)

PMID Year Title