Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.41
PubTator Score 8.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.4342644543142E-29
ependymoma 2514 1.02778783828064E-19
astrocytoma 1493 3.09875009133934E-16
oligodendroglioma 2849 4.74528690114265E-13
pilocytic astrocytoma 3086 1.61708355147632E-11
atypical teratoid / rhabdoid tumor 4369 2.44194737273078E-10
pediatric high grade glioma 2712 1.25537137368598E-8
non-small cell lung cancer 2798 5.10158486780933E-7
glioblastoma 5572 2.95500167807021E-6
osteosarcoma 7933 8.49612845486264E-6
medulloblastoma 1524 9.15609446903835E-6
medulloblastoma, large-cell 6234 1.4093711280056E-5
pituitary cancer 1972 1.27164278994428E-4
primitive neuroectodermal tumor 3031 0.00122692793630672
Pick disease 1893 0.00201000878987553
lung cancer 4473 0.0035814403593163

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -2.600 0.000
astrocytoma -1.200 0.000
glioblastoma -3.000 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.301 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.800 0.001
non-small cell lung cancer 1.394 0.000
lung cancer 1.100 0.004
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -2.800 0.000
lung carcinoma 1.700 0.000
Pick disease -1.400 0.002
pituitary cancer 1.300 0.000

Synonym

Accession Q9NRW1 B2R5Z9 B7Z337 D3DND3 Q92929
Symbols

Gene

PDB

2E9S   2FE4   2FFQ  

  Ortholog (4)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18044744 DYNLRB1 specifically interacts with all three Rab6 isoforms and co-localises at the Golgi.
17707369 The brain-specific Rab6B via Bicaudal-D1 is linked to the dynein/dynactin complex, suggesting a regulatory role for Rab6B in the retrograde transport of cargo in neuronal cells.
16790928 Conformational changes in human neuronal Rab6B between its inactive GDP and active GTP-like state are observed mainly in the switch I and switch II regions, confirming their role as a molecular switch.

AA Sequence

MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE     71 - 140
GEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC      141 - 208
//

Text Mined References (19)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21822290 2011 Modulation of Rab GTPase function by a protein phosphocholine transferase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18044744 2008 Rab6 family proteins interact with the dynein light chain protein DYNLRB1.
17707369 2007 A role for the Rab6B Bicaudal-D1 interaction in retrograde transport in neuronal cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...