Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
Funding $60,480
PubMed Score 20.66
PubTator Score 18.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (1)

PMID Text
15840583 Overexpression studies of the related SPEC1 showed that it also was recruited to the activated TCR. Mutational analysis revealed that localization of SPEC1 to the TCR required two N-terminal cysteine residues

AA Sequence

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD      1 - 70
RPWSNSRGL                                                                  71 - 79
//

Text Mined References (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17045588 2007 Biochemical characterization of distinct regions of SPEC molecules and their role in phagocytosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15840583 2005 The role of SPECs, small Cdc42-binding proteins, in F-actin accumulation at the immunological synapse.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11595176 2001 The genomic structure of the human SPEC1 gene reveals complex splicing and close promoter proximity to the AF1q translocation gene.
10816584 2000 SPECs, small binding proteins for Cdc42.