Property Summary

NCBI Gene PubMed Count 6
PubMed Score 21.44
PubTator Score 18.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia 1.300 1.4e-02
astrocytoma 1.300 7.7e-03
Breast cancer 2.400 2.6e-02
diabetes mellitus -1.300 3.6e-02
Duchenne muscular dystrophy 1.059 1.1e-08
ductal carcinoma in situ 1.200 2.8e-04
ependymoma -1.100 3.8e-02
glioblastoma 1.700 4.9e-04
group 3 medulloblastoma 1.100 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
invasive ductal carcinoma 1.100 7.5e-04
juvenile dermatomyositis 1.184 3.7e-13
limb girdle muscular dystrophy 2I 1.000 3.6e-04
medulloblastoma, large-cell -1.100 1.2e-04
osteosarcoma 1.845 1.8e-04
ovarian cancer -1.100 1.1e-05
pancreatic cancer 1.400 3.9e-03
primary pancreatic ductal adenocarcinoma 1.380 1.8e-03

Gene RIF (1)

AA Sequence

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD      1 - 70
RPWSNSRGL                                                                  71 - 79
//

Text Mined References (10)

PMID Year Title