Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.49
PubTator Score 8.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.322 6.0e-08
adrenocortical carcinoma 1.077 7.2e-04
adult high grade glioma -1.100 3.2e-03
atypical teratoid / rhabdoid tumor -1.300 1.1e-03
Breast cancer -1.100 1.0e-15
ductal carcinoma in situ 1.400 1.9e-03
Endometriosis -1.115 2.8e-02
glioblastoma -1.600 7.1e-05
group 4 medulloblastoma -1.200 9.8e-04
intraductal papillary-mucinous neoplasm ... 1.400 7.0e-03
invasive ductal carcinoma 1.100 1.8e-02
juvenile dermatomyositis 1.077 1.7e-10
medulloblastoma, large-cell -2.400 9.7e-05
osteosarcoma -1.257 1.6e-02
ovarian cancer -1.600 7.4e-06
pituitary cancer -1.200 6.0e-05
primary Sjogren syndrome 1.200 2.0e-03
primitive neuroectodermal tumor -1.200 2.1e-03
subependymal giant cell astrocytoma -1.178 3.8e-02
urothelial carcinoma -1.200 2.9e-03

Gene RIF (5)

AA Sequence

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGM      1 - 70
PANVQMQLVDTKAG                                                             71 - 84
//

Text Mined References (15)

PMID Year Title