Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.67
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.5649745708562E-9
ovarian cancer 8492 4.08799366361333E-7
malignant mesothelioma 3163 8.37977765047688E-7
pancreatic carcinoma 567 3.97042870512674E-5
pancreatic cancer 2300 3.97042870512679E-5
sonic hedgehog group medulloblastoma 1482 1.09975272601526E-4
Atopic dermatitis 944 0.00384626729019544
aldosterone-producing adenoma 664 0.0189090670807975
Disease Target Count Z-score Confidence
Specific language impairment 31 5.906 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer -1.200 0.000
malignant mesothelioma -1.200 0.000
osteosarcoma -2.221 0.000
sonic hedgehog group medulloblastoma 1.800 0.000
Atopic dermatitis -1.200 0.004
pancreatic carcinoma -1.200 0.000
aldosterone-producing adenoma -1.021 0.019
ovarian cancer -1.800 0.000

Synonym

Accession Q9NRM2 Q75MZ2 Q75MZ3 Q8WY14
Symbols NRIF4
ZNF277P

Gene

  Ortholog (11)

 MGI Term (1)

Gene RIF (2)

PMID Text
24518835 ZNF277 microdeletions might contribute to the risk of language impairments
19460752 Knockdown of zinc finger protein 277 (ZNF277) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVA      1 - 70
EQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVL     71 - 140
PEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNC    141 - 210
NEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLED    211 - 280
DRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVHMEDAHEFDLLKIKSELGLNFYQQVKLVNFI    281 - 350
RRQVHQCRCYGCHVKFKSKADLRTHMEETKHTSLLPDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQ    351 - 420
EQNENVPIISEDTSKLYALKQSSILNQLLL                                            421 - 450
//

Text Mined References (14)

PMID Year Title
24518835 2014 Homozygous microdeletion of exon 5 in ZNF277 in a girl with specific language impairment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16213364 2005 Finer delineation and transcript map of the 7q31 locus deleted in myeloid neoplasms.
12853948 2003 The DNA sequence of human chromosome 7.
More...