Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.71
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Specific language impairment 34 5.9 2.9

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.021 1.9e-02
Atopic dermatitis -1.200 3.8e-03
malignant mesothelioma -1.200 8.4e-07
medulloblastoma 1.100 2.4e-03
osteosarcoma -2.221 5.6e-09
ovarian cancer -1.400 7.6e-09
pancreatic cancer -1.200 4.0e-05
pancreatic carcinoma -1.200 4.0e-05

Gene RIF (2)

AA Sequence

MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVA      1 - 70
EQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVL     71 - 140
PEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNC    141 - 210
NEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLED    211 - 280
DRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVHMEDAHEFDLLKIKSELGLNFYQQVKLVNFI    281 - 350
RRQVHQCRCYGCHVKFKSKADLRTHMEETKHTSLLPDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQ    351 - 420
EQNENVPIISEDTSKLYALKQSSILNQLLL                                            421 - 450
//

Text Mined References (14)

PMID Year Title