Property Summary

NCBI Gene PubMed Count 131
PubMed Score 113.39
PubTator Score 149.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis -1.100 1.6e-03
lung carcinoma -1.100 2.9e-17
osteosarcoma -1.005 4.7e-04
ovarian cancer -1.300 2.4e-04
psoriasis 1.400 3.5e-04
tuberculosis 1.200 1.0e-05

Gene RIF (125)

AA Sequence

MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFL      1 - 70
YGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHT     71 - 140
LLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFIC    141 - 210
IGVFTGQLLGLPELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKA    211 - 280
DVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPP    281 - 350
AKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL    351 - 420
AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICIT    421 - 490
GAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP                        491 - 540
//

Text Mined References (133)

PMID Year Title