Property Summary

NCBI Gene PubMed Count 122
Grant Count 13
R01 Count 8
Funding $1,730,284.4
PubMed Score 110.68
PubTator Score 149.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma -1.005 0.000
tuberculosis 1.200 0.000
interstitial cystitis -1.200 0.000
lung carcinoma -1.100 0.000
ovarian cancer -1.300 0.000

Gene RIF (116)

PMID Text
26714568 SLC2A9 was associated with a decreased risk of gout in men (HR = 0.67, 95% CI: 0.49-0.91) and women (HR = 0.54, 95% CI: 0.33-0.89.
26607700 GLUT9 gene polymorphism predicts higher risk for cardiovascular diseases in patient diagnosed with hyperuricemia.
26603249 These results indicate that five newly described SNPs in the hURAT1 gene are significantly associated with uric acid level (4-2008-0318 and 4-2011-0277).
26552468 Demonstrate a significant association between rs2231142 in the ABCG2 gene and gout and identified novel SNPs, c.881A>G and c.1002+78G>A, in the SLC2A9 gene that may be associated with gout in a Korean population.
26345926 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations
26167684 single nucleotide polymorphisms in the SLC2A9 gene influence SLC2A9 gene expression as well as urinary uric acid excretion.
26125895 The SLC2A9 (rs7660895) and TOX (rs11777927) gene polymorphisms may be associated with formation of intracranial aneurysms, and rs7660895 may be associated with intracranial aneurysms rupture.
25922070 advances our understanding of how hSLC2A9 mediates urate and fructose transport, providing further information for developing pharmacological agents to treat hyperuricemia and related diseases, such as gout, hypertension, and diabetes
25889045 SLC2A9 genetic mutation is involved in renal excretion of uric acid.
25833971 genetic variation in SLC2A9 is associated with serum uric acid concentrations, an important biomarker of renal and cardiovascular disease risk, in Hispanic children
More...

AA Sequence

MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFL      1 - 70
YGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHT     71 - 140
LLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFIC    141 - 210
IGVFTGQLLGLPELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKA    211 - 280
DVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPP    281 - 350
AKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL    351 - 420
AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICIT    421 - 490
GAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP                        491 - 540
//

Text Mined References (124)

PMID Year Title
26714568 2016 Gout in Older Adults: The Atherosclerosis Risk in Communities Study.
26607700 2015 A genetic marker of hyperuricemia predicts cardiovascular events in a meta-analysis of three cohort studies in high risk patients.
26603249 2015 Discovery of URAT1 SNPs and association between serum uric acid levels and URAT1.
26552468 2015 Genetic analysis of ABCG2 and SLC2A9 gene polymorphisms in gouty arthritis in a Korean population.
26345926 2015 SLC2A9 and ZNF518B polymorphisms correlate with gout-related metabolic indices in Chinese Tibetan populations.
26167684 2015 SLC2A9 Genotype Is Associated with SLC2A9 Gene Expression and Urinary Uric Acid Concentration.
26125895 2015 Intracranial aneurysm risk factor genes: relationship with intracranial aneurysm risk in a Chinese Han population.
25922070 2015 Critical Roles of Two Hydrophobic Residues within Human Glucose Transporter 9 (hSLC2A9) in Substrate Selectivity and Urate Transport.
25889045 2015 An update on the genetic architecture of hyperuricemia and gout.
25833971 2015 Serum uric acid concentrations and SLC2A9 genetic variation in Hispanic children: the Viva La Familia Study.
More...