Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.43
PubTator Score 2.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 7.34263437961454E-80
breast carcinoma 1614 1.12493483051528E-40
nasopharyngeal carcinoma 1056 2.42996493642804E-7
lung cancer 4473 1.197112894201E-5
atypical teratoid / rhabdoid tumor 4369 2.54438562768654E-5
invasive ductal carcinoma 2950 8.79693284013753E-5
primary pancreatic ductal adenocarcinoma 1271 9.39847464859187E-4
pancreatic cancer 2300 0.00127296585701546
ependymoma 2514 0.00170365856695034
Pick disease 1893 0.00265293959934301
ductal carcinoma in situ 1745 0.00329356229750971
medulloblastoma, large-cell 6234 0.00404923812571948
oligodendroglioma 2849 0.00439996484110647
adult high grade glioma 2148 0.00556535805825149
glioblastoma 5572 0.00687878286614932
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0132841901830205
osteosarcoma 7933 0.0135973769090501
group 3 medulloblastoma 2254 0.015925239406293
astrocytic glioma 2241 0.0169415293882215
adrenocortical carcinoma 1427 0.0289051018602306
Hydrolethalus syndrome 128 0.0316982090028752
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.100 0.017
ependymoma -1.700 0.002
oligodendroglioma -1.400 0.004
osteosarcoma -2.524 0.014
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.400 0.007
medulloblastoma, large-cell -1.800 0.004
adrenocortical carcinoma -1.119 0.029
primary pancreatic ductal adenocarcinoma 1.842 0.001
intraductal papillary-mucinous carcinoma... -1.200 0.013
Hydrolethalus syndrome -1.618 0.032
lung cancer 2.200 0.000
breast carcinoma -2.000 0.000
adult high grade glioma -1.300 0.006
group 3 medulloblastoma -1.900 0.016
nasopharyngeal carcinoma -1.100 0.000
Breast cancer -4.500 0.000
Pick disease 1.200 0.003
ductal carcinoma in situ -1.500 0.003
invasive ductal carcinoma -2.600 0.000
pancreatic cancer 1.500 0.001

Synonym

Accession Q9NRE2 B7Z7W1 J3KNQ0 Q4VXM4 Q6N003 Q8N260
Symbols TSH2
ZABC2
ZNF218
OVC10-2
C20orf17

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (6)

PMID Text
21423795 TSHZ3 gene promoter was found to be methylated in all the breast/prostate cancer cell lines and some of the breast cancer clinical specimens while the TSHZ2 gene promoter was unmethylated except for the MDA-MB-231 breast cancer cell line.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19745106 Mutations in TSHZ2 and TSHZ3 are not a major cause of pelvi-ureteric junction obstruction, at least in Albanian and Macedonian populations.
19745106 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRRKQQAPKRAAGYAQEEQLKEEEEIKEEEEEEDSGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSP      1 - 70
GSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSG     71 - 140
LGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSKSLQQNLPSRSVSKPSLFSSVQLYRQSSKMCGTVFT    141 - 210
GASRFRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFC    211 - 280
GDSFDSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSFADSFSSQKNA    281 - 350
NLQLSSNNRYGYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLV    351 - 420
LDPLAVEKMQSLSEAPNSDSLAPKPSSNSASDCTASTTELKKESKKERPEETSKDEKVVKSEDYEDPLQK    421 - 490
PLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSEGTKPPLPM    491 - 560
GSQVLQIRPNLTNKLRPIAPKWKVMPLVSMPTHLAPYTQVKKESEDKDEAVKECGKESPHEEASSFSHSE    561 - 630
GDSFRKSETPPEAKKTELGPLKEEEKLMKEGSEKEKPQPLEPTSALSNGCALANHAPALPCINPLSALQS    631 - 700
VLNNHLGKATEPLRSPSCSSPSSSTISMFHKSNLNVMDKPVLSPASTRSASVSRRYLFENSDQPIDLTKS    701 - 770
KSKKAESSQAQSCMSPPQKHALSDIADMVKVLPKATTPKPASSSRVPPMKLEMDVRRFEDVSSEVSTLHK    771 - 840
RKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFTGLSMTTISHWLANVKYQLRKT    841 - 910
GGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRLSVDQQSKVEQEISRVSSAQRS    911 - 980
PETIAAEEDTDSKFKCKLCCRTFVSKHAVKLHLSKTHSKSPEHHSQFVTDVDEE                    981 - 1034
//

Text Mined References (18)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
21423795 2011 Rare and frequent promoter methylation, respectively, of TSHZ2 and 3 genes that are both downregulated in expression in breast and prostate cancers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19745106 2010 Analysis of TSHZ2 and TSHZ3 genes in congenital pelvi-ureteric junction obstruction.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
More...