Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.78
PubTator Score 2.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Breast cancer -1.300 7.1e-71
adrenocortical carcinoma -1.119 2.9e-02
adult high grade glioma -1.300 5.6e-03
astrocytic glioma -1.100 1.7e-02
atypical teratoid / rhabdoid tumor -1.600 2.5e-05
breast carcinoma -1.100 1.2e-05
ductal carcinoma in situ -1.500 3.3e-03
ependymoma -1.400 8.2e-03
glioblastoma -1.400 6.9e-03
group 3 medulloblastoma -1.600 5.8e-03
Hydrolethalus syndrome -1.175 3.1e-02
intraductal papillary-mucinous carcinoma... -1.200 1.3e-02
invasive ductal carcinoma -2.600 8.8e-05
lung cancer 1.100 1.8e-03
medulloblastoma, large-cell -1.200 3.0e-02
nasopharyngeal carcinoma -1.100 2.4e-07
oligodendroglioma -1.200 2.4e-02
osteosarcoma 1.242 2.4e-03
pancreatic cancer 1.300 4.2e-03
Pick disease 1.200 2.7e-03
primary pancreatic ductal adenocarcinoma 1.459 2.5e-03

Gene RIF (7)

AA Sequence

MPRRKQQAPKRAAGYAQEEQLKEEEEIKEEEEEEDSGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSP      1 - 70
GSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSG     71 - 140
LGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSKSLQQNLPSRSVSKPSLFSSVQLYRQSSKMCGTVFT    141 - 210
GASRFRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFC    211 - 280
GDSFDSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSFADSFSSQKNA    281 - 350
NLQLSSNNRYGYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLV    351 - 420
LDPLAVEKMQSLSEAPNSDSLAPKPSSNSASDCTASTTELKKESKKERPEETSKDEKVVKSEDYEDPLQK    421 - 490
PLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSEGTKPPLPM    491 - 560
GSQVLQIRPNLTNKLRPIAPKWKVMPLVSMPTHLAPYTQVKKESEDKDEAVKECGKESPHEEASSFSHSE    561 - 630
GDSFRKSETPPEAKKTELGPLKEEEKLMKEGSEKEKPQPLEPTSALSNGCALANHAPALPCINPLSALQS    631 - 700
VLNNHLGKATEPLRSPSCSSPSSSTISMFHKSNLNVMDKPVLSPASTRSASVSRRYLFENSDQPIDLTKS    701 - 770
KSKKAESSQAQSCMSPPQKHALSDIADMVKVLPKATTPKPASSSRVPPMKLEMDVRRFEDVSSEVSTLHK    771 - 840
RKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFTGLSMTTISHWLANVKYQLRKT    841 - 910
GGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRLSVDQQSKVEQEISRVSSAQRS    911 - 980
PETIAAEEDTDSKFKCKLCCRTFVSKHAVKLHLSKTHSKSPEHHSQFVTDVDEE                    981 - 1034
//

Text Mined References (20)

PMID Year Title