Property Summary

NCBI Gene PubMed Count 11
PubMed Score 60.66
PubTator Score 62.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS      1 - 70
KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE                 71 - 128
//

Text Mined References (11)

PMID Year Title