Property Summary

NCBI Gene PubMed Count 47
PubMed Score 153.03
PubTator Score 51.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (40)

AA Sequence

MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTELQGRSRRREG      1 - 70
LKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADL     71 - 140
SEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVCTSCVPNREYVRVFDV    141 - 210
TERTALHRHQTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRL    211 - 280
WCMTKPPSRRPKLYIVNLQWTPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAG    281 - 350
EEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT                        351 - 400
//

Text Mined References (52)

PMID Year Title