Property Summary

NCBI Gene PubMed Count 35
Grant Count 5
Funding $133,994.17
PubMed Score 125.37
PubTator Score 51.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26867678 SIRT7 deacetylates U3-55k, enhancing U3-55k binding to U3 snoRNA, which is a prerequisite for pre-rRNA processing.
26704017 this is the first report on the regulation mechanism of SIRT7 gene, in which, HDAC3 collaborated with C/EBPalpha to occupy its responding element in the upstream region of SIRT7 gene and repressed its expression in human cells.
26169984 Novel interactions of TPPII, p53, and SIRT7 presented in this study might contribute to the knowledge of the regulatory effects of these proteins on apoptotic pathways and to the understanding mechanisms of aging and lifespan regulation.
26121130 SIRT3 and SIRT7 possess tumour suppressor properties in the context of pancreatic cancer.
25973086 Sirt7 expression was implicated with high histological grade and independently predicted poor clinical outcome in patients with breast cancer, suggesting that Sirt7 might play a role in the malignant progression of breast cancer.
25921180 SIRT7 might play a role of oncogene in ovarian malignancy. Down-regulation of SIRT7 significantly reduced ovarian cancer cell growth, repressed colony formation and increased cancer cell apoptosis; up-regulation promoted the migration of cancer cells.
25860861 Sirt7 is overexpressed in human gastric cancers. Expression of Sirt7 is markedly correlated with tumor size, metastasis, disease stage and prognosis.
25794641 SIRT1 inhibition caused cell death, while SIRT2 inhibition resulted in cell cycle arrest. In conclusion, we report the overexpression of SIRT2 and SIRT7 proteins in cervical cancer
25792330 SIRT7 expression was reduced in aged hematopoietic stem cells (HSCs), and SIRT7 up-regulation improved the regenerative capacity of aged HSCs.
25503141 In the cancer group, the expression level of SIRT6 and SIRT7 were significantly up-regulated and are potential circulating prognostic markers for head and neck squamous cell carcinoma.
More...

AA Sequence

MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTELQGRSRRREG      1 - 70
LKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADL     71 - 140
SEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVCTSCVPNREYVRVFDV    141 - 210
TERTALHRHQTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRL    211 - 280
WCMTKPPSRRPKLYIVNLQWTPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAG    281 - 350
EEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT                        351 - 400
//

Text Mined References (39)

PMID Year Title
26867678 2016 SIRT7-dependent deacetylation of the U3-55k protein controls pre-rRNA processing.
26704017 2016 C/EBP? negatively regulates SIRT7 expression via recruiting HDAC3 to the upstream-promoter of hepatocellular carcinoma cells.
26169984 2015 Novel protein-protein interactions of TPPII, p53, and SIRT7.
26121130 2015 SIRT3 & SIRT7: Potential Novel Biomarkers for Determining Outcome in Pancreatic Cancer Patients.
25973086 2015 High expression of Sirt7 served as a predictor of adverse outcome in breast cancer.
25921180 2015 SIRT7 Exhibits Oncogenic Potential in Human Ovarian Cancer Cells.
25860861 2015 Sirt7 promotes gastric cancer growth and inhibits apoptosis by epigenetically inhibiting miR-34a.
25794641 2015 Expression/localization patterns of sirtuins (SIRT1, SIRT2, and SIRT7) during progression of cervical cancer and effects of sirtuin inhibitors on growth of cervical cancer cells.
25792330 2015 Stem cell aging. A mitochondrial UPR-mediated metabolic checkpoint regulates hematopoietic stem cell aging.
25503141 2014 The potential of SIRT6 and SIRT7 as circulating markers for head and neck squamous cell carcinoma.
More...