Property Summary

NCBI Gene PubMed Count 50
Grant Count 195
R01 Count 112
Funding $22,911,914.14
PubMed Score 131.71
PubTator Score 145.60

Knowledge Summary

Patent (11,607)

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.100 0.006

Synonym

Accession Q9NRA0 A0T4C8 B4DU87 Q9BRN1 Q9H0Q2 Q9NWU7 SK 2
Symbols SK 2
SK-2
SPK 2
SPK-2

Gene

Gene RIF (33)

PMID Text
26886371 increased SK and SPL mRNA expression along with reduced sphingosine 1-phosphate levels were more commonly observed in hepatocellular carcinoma tissues.
26494858 ABC294640 may reduce the proliferative capacity of castration-resistant prostate cancer cells through inhibition of both sphingosine kinase 2 and dihydroceramide desaturase.
26337959 Targeting of SphK2 by ABC294640 potently inhibits colorectal cancer cell growth both in vitro and in vivo.
26209696 results define new mechanistic insights for EGF-mediated invasion and novel actions of SK2
25808826 Because of the unique relationship observed after serum depletion, we examined effects of siRNA for SPHK2, and found the role of SPHK2 as a growth or survival factor but not a cell proliferation inhibitor in FCS(-) culture
25455157 Down-regulation of SphK2 increased the effects of all-trans-retinoic acid on colon cancer cells.
25010828 These data illuminate a novel survival mechanism and potential therapeutic target for KSHV-infected endothelial cells: SphK2-associated maintenance of viral latency
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
24709100 SPHK2 regulates apoptosis in colon cancer cells.
24686171 Results demonstrated that SK2 regulates MYC, which has a pivotal role in hematologic malignancies.
More...

AA Sequence

MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPARGPRFALTLT      1 - 70
SQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGARRRATRTFRADGA     71 - 140
ATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISE    141 - 210
AGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGN    211 - 280
ALAGAVNQHGGFEPALGLDLLLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERF    281 - 350
RALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV    351 - 420
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGA    421 - 490
PVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHAR    491 - 560
FDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGP    561 - 630
LQAQMHPGIGTLLTGPPGCPGREP                                                  631 - 654
//

Text Mined References (54)

PMID Year Title
26886371 2016 Increased mRNA Levels of Sphingosine Kinases and S1P Lyase and Reduced Levels of S1P Were Observed in Hepatocellular Carcinoma in Association with Poorer Differentiation and Earlier Recurrence.
26494858 2015 The Sphingosine Kinase 2 Inhibitor ABC294640 Reduces the Growth of Prostate Cancer Cells and Results in Accumulation of Dihydroceramides In Vitro and In Vivo.
26337959 2015 Targeting sphingosine kinase 2 (SphK2) by ABC294640 inhibits colorectal cancer cell growth in vitro and in vivo.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
25808826 2015 Increased SPHK2 Transcription of Human Colon Cancer Cells in Serum-Depleted Culture: The Involvement of CREB Transcription Factor.
25455157 2014 Down-regulation of sphingosine kinase 2 (SphK2) increases the effects of all-trans-retinoic acid (ATRA) on colon cancer cells.
25010828 2014 Sphingosine kinase-2 maintains viral latency and survival for KSHV-infected endothelial cells.
24903384 2014 The role of sphingosine kinase isoforms and receptors S1P1, S1P2, S1P3, and S1P5 in primary, secondary, and recurrent glioblastomas.
24709100 2014 Sodium butyrate induces apoptosis of human colon cancer cells by modulating ERK and sphingosine kinase 2.
24686171 2014 Sphingosine kinase 2 promotes acute lymphoblastic leukemia by enhancing MYC expression.
More...