Property Summary

Ligand Count 2
NCBI Gene PubMed Count 58
PubMed Score 154.90
PubTator Score 145.60

Knowledge Summary

Patent (11,607)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Infarction, Middle Cerebral Artery 33 0.0 0.0
Memory Disorders 40 0.0 0.0
Disease Target Count P-value
lung cancer 4740 5.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.562 1.8
Multiple Sclerosis 540 3.507 1.8
Lymphopenia 67 3.502 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.100 5.7e-03

 GWAS Trait (1)

Gene RIF (41)

AA Sequence

MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPARGPRFALTLT      1 - 70
SQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGARRRATRTFRADGA     71 - 140
ATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISE    141 - 210
AGLSFNLIQTERQNHARELVQGLSLSEWDGIVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGN    211 - 280
ALAGAVNQHGGFEPALGLDLLLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERF    281 - 350
RALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV    351 - 420
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGA    421 - 490
PVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHAR    491 - 560
FDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGP    561 - 630
LQAQMHPGIGTLLTGPPGCPGREP                                                  631 - 654
//

Text Mined References (62)

PMID Year Title