Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.51
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.500 2.6e-04
astrocytic glioma -1.400 1.1e-02
Astrocytoma, Pilocytic -2.700 5.9e-08
atypical teratoid / rhabdoid tumor -2.200 2.0e-03
ependymoma -1.400 2.0e-02
glioblastoma -2.700 7.7e-13
group 4 medulloblastoma -2.500 3.3e-04
oligodendroglioma -1.400 1.2e-02

Gene RIF (7)

AA Sequence

MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWGPSQSRLLKSQERSGVSTFWK      1 - 70
KPSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHE     71 - 140
KGLVLQELKVEPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFRKMESYLKQQQ    141 - 210
LCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKED    211 - 280
TIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF    281 - 350
LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQILADLENHALF    351 - 420
KNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAG    421 - 490
MMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLGVTVLEGPIYAVGG    491 - 560
HDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNGKLYSVGGRDGSSCLSSMEYYDPHTNKWNMC    561 - 630
APMCKRRGGVGVATCDGFLYAVGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGD    631 - 700
RLYAVGGYDGQTYLNTMESYDPQTNEWTQMASLNIGRAGACVVVIKQP                          701 - 748
//

Text Mined References (18)

PMID Year Title