Property Summary

NCBI Gene PubMed Count 13
PubMed Score 79.74
PubTator Score 12.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.257 1.3e-03
diabetes mellitus -1.100 2.5e-02
glioblastoma 1.300 9.4e-04
intraductal papillary-mucinous carcinoma... 1.300 1.2e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-03
Multiple myeloma 1.196 4.7e-03
ovarian cancer 2.800 1.4e-08
pituitary cancer -1.800 1.0e-07

Gene RIF (4)

AA Sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP      1 - 70
YTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNF     71 - 140
PYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI    141 - 210
PIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL    211 - 280
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV    281 - 350
DNHGKKIKS                                                                 351 - 359
//

Text Mined References (17)

PMID Year Title