Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 4
Funding $468,870.67
PubMed Score 76.16
PubTator Score 12.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9NR45 B2RE98 Q8WUV9 Q9BWS6 Q9NVD4
Symbols SAS
SEMDG
SEMDCG
HEL-S-100

Gene

PANTHER Protein Class (2)

PDB

1WVO  

Gene RIF (3)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
16597820 The structure of the C-terminal antifreeze-like domain of human sialic acid synthase was determined. The structure comprises one alpha- and two single-turn 3(10)-helices and two beta-strands, and is similar to those of the type III antifreeze proteins.
16274664 sialic acid synthases kinetics and preliminary mutagenesis experiments reveal the importance of C-terminal antifreeze protein domain

AA Sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP      1 - 70
YTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNF     71 - 140
PYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI    141 - 210
PIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL    211 - 280
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV    281 - 350
DNHGKKIKS                                                                 351 - 359
//

Text Mined References (17)

PMID Year Title
27213289 2016 NANS-mediated synthesis of sialic acid is required for brain and skeletal development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16597820 2006 Solution structure of the antifreeze-like domain of human sialic acid synthase.
16274664 2005 Cloning, expression, and characterization of sialic acid synthases.
More...