Property Summary

NCBI Gene PubMed Count 21
Grant Count 17
R01 Count 7
Funding $861,596
PubMed Score 81.22
PubTator Score 58.80

Knowledge Summary

Patent

No data available

Gene RIF (14)

PMID Text
25372014 The results expand the spectrum of mutations associated with CHDs and first suggest the potentially disease-related GDF3 gene variant in the pathogenesis of CHDs.
22963770 first evidence that NANOG is a transcriptional activator of the expression of the oncogenic growth factor GDF3 in embryonic carcinoma cells
22488170 GDF3 expression level was significantly down-regulated in breast cancer tissues compared to the surrounding nontumorous tissues.
22305102 Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells.
21805089 the conditioned medium from CHO-GDF3 could reduce PC12 cell growth and induce cell differentiation
20800603 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19864492 Mutation of GDF3 causes ocular and skeletal anomalies.
19396148 GDF3 positivity is helpful in the diagnosis of yolk sac tumor
More...

AA Sequence

MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREAAATTGVSRDL      1 - 70
CYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKEREQLTLAQLGLDLGPNSYYNLG     71 - 140
PELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVHFNLLDVAKDWNDNPRKNFGLFLEILVKEDR    141 - 210
DSGVNFQPEDTCARLRCSLHASLLVVTLNPDQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHK    211 - 280
WIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVIL    281 - 350
RHYEDMVVDECGCG                                                            351 - 364
//

Text Mined References (22)

PMID Year Title
25372014 2015 A novel variation of GDF3 in Chinese Han children with a broad phenotypic spectrum of non-syndromic CHDs.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
22963770 2012 Regulation of human growth and differentiation factor 3 gene expression by NANOG in human embryonic carcinoma NCCIT cells.
22488170 2012 GDF3 inhibits the growth of breast cancer cells and promotes the apoptosis induced by Taxol.
22305102 2012 Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells.
21805089 2012 The conditioned medium from a stable human GDF3-expressing CHO cell line, induces the differentiation of PC12 cells.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19864492 2010 Mutation of the bone morphogenetic protein GDF3 causes ocular and skeletal anomalies.
More...