Property Summary

NCBI Gene PubMed Count 22
PubMed Score 87.38
PubTator Score 58.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Coloboma 51 4.929 2.5
Disease Target Count Z-score Confidence
Microphthalmia 76 4.975 2.5

Expression

Protein-protein Interaction (3)

Gene RIF (15)

AA Sequence

MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREAAATTGVSRDL      1 - 70
CYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKEREQLTLAQLGLDLGPNSYYNLG     71 - 140
PELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVHFNLLDVAKDWNDNPRKNFGLFLEILVKEDR    141 - 210
DSGVNFQPEDTCARLRCSLHASLLVVTLNPDQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHK    211 - 280
WIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVIL    281 - 350
RHYEDMVVDECGCG                                                            351 - 364
//

Text Mined References (23)

PMID Year Title