Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.35
PubTator Score 11.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9NR22 B2RDP0 Q8TBJ8
Symbols HRMT1L3
HRMT1L4

Gene

PANTHER Protein Class (2)

PDB

4X41   5DST  

Gene RIF (10)

PMID Text
26876602 Biochemical, biophysical and mutagenesis experiments demonstrated that hPRMT8 forms an octamer in solution.
23946480 automethylation of the N terminus likely regulates PRMT8 activity by decreasing the affinity of the enzyme for AdoMet
23635657 Mutational defects in PRMT8 is not the cause of frontotemporal lobar degeneration.
23620769 wild type FUS (FUS-WT) specifically interacts with protein arginine methyltransferases 1 and 8 (PRMT1 and PRMT8) and undergoes asymmetric dimethylation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18698489 EWS is a substrate for PRMT8, as efficient as for PRMT1
18320585 The interaction between PRMT8 and the EWS protein was charcterized.
17925405 PRMT8 N-terminal domain may function as an autoregulator that may be displaced by interaction with one or more physiological inducers.
16051612 PRMT8 is an active arginine methyltransferase that is membrane-associated and tissue-specific

AA Sequence

MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEM      1 - 70
TSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI     71 - 140
ECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP    141 - 210
GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDI    211 - 280
YTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRR    281 - 350
GEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR                              351 - 394
//

Text Mined References (19)

PMID Year Title
26876602 2016 Novel helical assembly in arginine methyltransferase 8.
25416956 2014 A proteome-scale map of the human interactome network.
23946480 2013 Automethylation of protein arginine methyltransferase 8 (PRMT8) regulates activity by impeding S-adenosylmethionine sensitivity.
23635657 2013 Mutations in protein N-arginine methyltransferases are not the cause of FTLD-FUS.
23620769 2013 Protein arginine methyltransferase 1 and 8 interact with FUS to modify its sub-cellular distribution and toxicity in vitro and in vivo.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060904 2009 An empirical framework for binary interactome mapping.
18698489 2008 EWS is a substrate of type I protein arginine methyltransferase, PRMT8.
More...