Property Summary

Ligand Count 20
NCBI Gene PubMed Count 18
PubMed Score 20.53
PubTator Score 11.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.800 2.0e-03
Alzheimer's disease -1.100 3.2e-02
astrocytic glioma -2.000 2.8e-03
Astrocytoma, Pilocytic -2.200 2.1e-07
atypical teratoid / rhabdoid tumor -2.000 2.1e-09
ependymoma -1.700 1.0e-02
glioblastoma -2.000 8.7e-10
group 4 medulloblastoma -1.500 1.0e-02
lung carcinoma 1.600 2.6e-19
medulloblastoma, large-cell -1.300 4.8e-02
oligodendroglioma -1.500 1.0e-02
Pick disease -1.300 1.0e-03
primitive neuroectodermal tumor -1.300 5.6e-03
subependymal giant cell astrocytoma -1.494 4.4e-02

Gene RIF (10)

AA Sequence

MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEM      1 - 70
TSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI     71 - 140
ECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP    141 - 210
GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDI    211 - 280
YTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRR    281 - 350
GEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR                              351 - 394
//

Text Mined References (19)

PMID Year Title