Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.35
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9NQZ5 D3DXG9 Q53T44 Q6GU43 Q969M6
Symbols GTT1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (8)

AA Sequence

MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPG      1 - 70
HASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQR     71 - 140
WEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGS    141 - 210
EVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFD    211 - 280
ENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKAT    281 - 350
SQSSERKNEGSCGPARIEYA                                                      351 - 370
//

Text Mined References (18)

PMID Year Title