Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
R01 Count 2
Funding $258,050
PubMed Score 14.95
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22952907 StarD7 modulates ABCG2 multidrug transporter level, cell migration, proliferation, and biochemical and morphological differentiation marker expression in a human trophoblast cell model.
22063720 StarD7 behaves as a fusogenic protein in model and cell membrane bilayers.
21622533 The SF-1 and beta-catenin pathway convergence on StarD7 expression may have important implications in the phospholipid uptake and transport, contributing to the normal trophoblast development.
20042613 These results suggest that StarD7 facilitates the delivery of phosphatidylcholine to mitochondria in non-vesicular system.
19679347 Beta-catenin and TCF4 activate the human StarD7 gene interacting with its promoter region through Wnt/beta-catenin signalling.
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 1 is discussed

AA Sequence

MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPG      1 - 70
HASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQR     71 - 140
WEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGS    141 - 210
EVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFD    211 - 280
ENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKAT    281 - 350
SQSSERKNEGSCGPARIEYA                                                      351 - 370
//

Text Mined References (16)

PMID Year Title
25980009 2015 Haploinsufficiency for Stard7 is associated with enhanced allergic responses in lung and skin.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22952907 2012 StarD7 knockdown modulates ABCG2 expression, cell migration, proliferation, and differentiation of human choriocarcinoma JEG-3 cells.
22063720 2012 StarD7 behaves as a fusogenic protein in model and cell membrane bilayers.
21622533 2011 StarD7 gene expression in trophoblast cells: contribution of SF-1 and Wnt-beta-catenin signaling.
21269460 2011 Initial characterization of the human central proteome.
20042613 2010 StarD7 mediates the intracellular trafficking of phosphatidylcholine to mitochondria.
19679347 2009 Activation of beta-catenin signalling increases StarD7 gene expression in JEG-3 cells.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
More...