Property Summary

NCBI Gene PubMed Count 66
Grant Count 30
R01 Count 21
Funding $3,621,794.42
PubMed Score 174.19
PubTator Score 187.24

Knowledge Summary

Patent

No data available

Gene RIF (48)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
26149076 Susceptibility of gr/gr rearrangements to azoospermia or oligozoospermia is dependent on DAZ and CDY1 gene copy deletions.
25994570 Overexpression of DAZ1 is associated with breast tumors.
25916124 We did not found any statistically significant genetic association between DAZ alleles and idiopathic male infertility
24935076 genetic association study in Chinese population: Data suggest that combined patterns of copy number abnormality in DAZ1 (deleted in azoospermia 1) and/or BPY2 (basic charge Y-linked protein 2) are associated with spermatogenic impairment/azoospermia.
23696539 genetic association studies in Han population in China: Data suggest that AZF1/DAZ1 duplications underlie genetic predisposition of Y-chromosome haplogroup K* to spermatogenic impairment (azoospermia/oligospermia) in the population studied.
23512232 There appears to be an asociation of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
23422238 Report the prevalence of variations in the AZFc region of the human Y chromosome in infertile men.
20663794 Observational study of gene-disease association. (HuGE Navigator)
20170395 The methylation patterns of CpG island (CGI) in the DAZ gene promoter region were different between somatic cells and spermatic cells
More...

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVG    141 - 210
GIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIR    211 - 280
KQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQ    281 - 350
SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVND    351 - 420
VDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNP    421 - 490
VTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGY    491 - 560
QLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVAT    561 - 630
GYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQV    631 - 700
TTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD                              701 - 744
//

Text Mined References (66)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
26162009 2015 Isoform-Level Gene Expression Profiles of Human Y Chromosome Azoospermia Factor Genes and Their X Chromosome Paralogs in the Testicular Tissue of Non-Obstructive Azoospermia Patients.
26149076 2015 Susceptibility of gr/gr rearrangements to azoospermia or oligozoospermia is dependent on DAZ and CDY1 gene copy deletions.
25994570 2015 Transcriptome analysis of the cancer/testis genes, DAZ1, AURKC, and TEX101, in breast tumors and six breast cancer cell lines.
25916124 [The association between DAZ T > C polymorphism and idiopathic male infertility risk in north of Iran].
24935076 2014 Gene copy number alterations in the azoospermia-associated AZFc region and their effect on spermatogenic impairment.
23696539 2013 DAZ duplications confer the predisposition of Y chromosome haplogroup K* to non-obstructive azoospermia in Han Chinese populations.
23512232 2013 Association of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
23422238 2014 Analysis of DAZ gene expression in a partial AZFc deletion of the human Y chromosome.
20663794 2010 Features of constitutive gr/gr deletion in a Japanese population.
More...