Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.58
PubTator Score 21.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -2.921 6.0e-10
chronic rhinosinusitis -1.133 9.8e-03
colon cancer -2.200 3.7e-02
hepatocellular carcinoma -1.300 2.8e-04
intraductal papillary-mucinous neoplasm ... -2.000 9.3e-03
lung cancer -1.500 4.7e-04
non-small cell lung cancer -1.674 6.7e-15
osteosarcoma -1.547 2.3e-05
ovarian cancer 1.600 3.5e-04
pituitary cancer -1.700 2.0e-04
tuberculosis -2.200 1.5e-04

Gene RIF (7)

AA Sequence

MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEKNIHEIRASKR      1 - 70
NSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAF     71 - 140
SRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGSSLVIHKRIHT    141 - 210
GEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAF    211 - 280
ICGSSLIQHKRIHTGEKPYECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHT    281 - 350
GEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSF    351 - 420
SHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS                               421 - 463
//

Text Mined References (21)

PMID Year Title