Property Summary

NCBI Gene PubMed Count 25
PubMed Score 58.25
PubTator Score 22.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.700 7.9e-32
cystic fibrosis 1.019 1.2e-03
ependymoma 1.100 2.9e-05
group 3 medulloblastoma 1.300 1.2e-02
invasive ductal carcinoma -1.100 1.5e-04
lung adenocarcinoma -1.300 6.9e-22
lung carcinoma -1.700 1.5e-26
ovarian cancer -3.000 1.2e-14

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI      1 - 70
LDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAVEDIETDTELLIGYLDSDMEAEEEEQQIMTV     71 - 140
IKEGEVENSRRQSTAGRKDRLGCKEDYACPQCESSFTSEDILAEHLQTLHQKPTEEKEFKCKNCGKKFPV    141 - 210
KQALQRHVLQCTAKSSLKESSRSFQCSVCNSSFSSASSFEQHQETCRGDARFVCKADSCGKRLKSKDALK    211 - 280
RHQENVHTGDPKKKLICSVCNKKCSSASSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNC    281 - 350
EICNKSFKRLDQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ    351 - 420
RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHKKTHTGEKEKI    421 - 490
CPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHTREKPYKCSECSKAFSQKRGL    491 - 560
DEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRPLAECQFCHKKFTRNDYLKVHMDNIHGVADS    561 - 630
//

Text Mined References (27)

PMID Year Title