Property Summary

NCBI Gene PubMed Count 38
PubMed Score 100.54
PubTator Score 50.24

Knowledge Summary

Patent (2,652)


  Disease (7)

Disease Target Count Z-score Confidence
Achromatopsia 3 1 0.0 0.0
Stargardt Disease 1 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.3
Kidney cancer 2548 0.0 0.7
Melanoma 689 0.0 0.6
lung cancer 4607 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 1.0
Disease Target Count Z-score Confidence
cone-rod dystrophy 57 0.0 5.0
Disease Target Count
Cone dystrophy 68
Achromatopsia 16


Gene RIF (30)

AA Sequence

RRTVLPRGTSRQSLIISMAPSAEGGEEVLTIEVKEKAKQ                                   771 - 809

Text Mined References (40)

PMID Year Title