Property Summary

Ligand Count 1
NCBI Gene PubMed Count 38
PubMed Score 100.54
PubTator Score 50.24

Knowledge Summary

Patent (2,652)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Achromatopsia 3 1 0.0 0.0
Stargardt Disease 1 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7
Melanoma 711 0.0 0.6
lung cancer 4740 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.0
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 0.0 5.0
Disease Target Count
Cone dystrophy 71
Achromatopsia 16

Expression

Gene RIF (30)

AA Sequence

MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPVTSEEPHTNIQ      1 - 70
DKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPAAPVINEYADAQLHNLVKRMR     71 - 140
QRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYLKRIKLPNSI    141 - 210
DSYTDRLYLLWLLLVTLAYNWNCCFIPLRLVFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRG    211 - 280
GDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFFGFNPMFRANRMLKYTSFFEFNHHLESIMDKAYI    281 - 350
YRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYDGEGNEYLRCYYWAVRTLITIGGLPEPQTLFEI    351 - 420
VFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQ    421 - 490
RMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKE    491 - 560
MYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTLQEILVH    561 - 630
YPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQAA    631 - 700
QKKENSEGGEEEGKENEDKQKENEDKQKENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVEEEPHSV    701 - 770
RRTVLPRGTSRQSLIISMAPSAEGGEEVLTIEVKEKAKQ                                   771 - 809
//

Text Mined References (40)

PMID Year Title