Property Summary

NCBI Gene PubMed Count 58
Grant Count 27
R01 Count 16
Funding $2,826,202.62
PubMed Score 62.52
PubTator Score 79.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.107 1.6
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.046 0.000

Gene RIF (45)

PMID Text
26953260 analysis of a structural model for how Set8 uses multivalent interactions to bind and methylate the nucleosome based on crystallographic and solution studies of the Set8/nucleosome complex
26717907 SET8 and ZEB1 are functionally interdependent in promoting the epithelial-mesenchymal transition and enhancing the invasive potential of prostate cancer cells in vitro.
26707641 Overall, the results revealed that miR-127-3p acts as a tumor suppressor and that its down-regulation in cancer may contribute to OS progression and metastasis.
26666832 This study showed SCF(beta-TRCP) earmarks Set8 for ubiquitination and degradation in a casein kinase I-dependent manner, which is activated by DNA-damaging agents.
26634528 SET8 expression is associated with overall survival in gastric cancer
25343552 The SNP in the miR502 binding site of the SET8 3'-untranslated region seems to influence survival of non-Hodgkin's lymphoma.
25252681 SET8 is required for 53BP1 recruitment and efficient repair of DSB.
25169478 These data suggest that there are significant associations between the miR-502-binding site single nucleotide polymorphism in the 3'-UTR of SET8 and the TP53 codon 72 polymorphism with cervical cancer in Chinese, and there is a gene-gene interaction.
25137013 commonality of SPS8I1-3 against SETD8, together with their distinct structures and mechanisms for SETD8 inhibition, argues for the collective application of these compounds as SETD8 inhibitors
25048968 Our results demonstrated that SETD8 rs16917496 C/T polymorphism was associated with decreased risk of developing pediatric acute lymphoblastic leukemia
More...

AA Sequence

MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAAAAVAATAPGP      1 - 70
EMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKR     71 - 140
NAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRK    141 - 210
KAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRG    211 - 280
DFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKL    281 - 350
HDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH                               351 - 393
//

Text Mined References (65)

PMID Year Title
26953260 2016 Multivalent Interactions by the Set8 Histone Methyltransferase With Its Nucleosome Substrate.
26717907 2016 SET8 induces epithelial?mesenchymal transition and enhances prostate cancer cell metastasis by cooperating with ZEB1.
26707641 2016 MicroRNA-127-3p inhibits proliferation and invasion by targeting SETD8 in human osteosarcoma cells.
26666832 2015 SCF(?-TRCP) promotes cell growth by targeting PR-Set7/Set8 for degradation.
26634528 2015 SET8 expression is associated with overall survival in gastric cancer.
25343552 Prognostic value of microRNA 502 binding site SNP in the 3'-untranslated region of the SET8 gene in patients with non-Hodgkin's lymphoma.
25252681 2014 SET8 methyltransferase activity during the DNA double-strand break response is required for recruitment of 53BP1.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25169478 2014 Association of a miR-502-binding site single nucleotide polymorphism in the 3'-untranslated region of SET8 and the TP53 codon 72 polymorphism with cervical cancer in the Chinese population.
25137013 2014 Small-molecule inhibitors of SETD8 with cellular activity.
More...