Property Summary

Ligand Count 3
NCBI Gene PubMed Count 66
PubMed Score 71.75
PubTator Score 79.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.3e-10
Disease Target Count Z-score Confidence
Cancer 2499 3.254 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.046 2.3e-10

Gene RIF (53)

AA Sequence

MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAAAAVAATAPGP      1 - 70
EMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKR     71 - 140
NAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRK    141 - 210
KAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRG    211 - 280
DFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKL    281 - 350
HDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH                               351 - 393
//

Text Mined References (73)

PMID Year Title