Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.17
PubTator Score 10.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 4.6e-04
astrocytic glioma -1.100 3.8e-02
atypical teratoid / rhabdoid tumor -1.300 2.2e-06
Breast cancer 2.700 2.8e-02
colon cancer 1.600 2.6e-02
ependymoma -1.200 4.6e-02
glioblastoma -1.300 1.3e-03
hereditary spastic paraplegia -1.420 6.1e-03
lung cancer 2.900 1.3e-05
Multiple myeloma 2.109 4.8e-03
nasopharyngeal carcinoma 1.500 7.1e-05
osteosarcoma 1.582 4.2e-07
psoriasis 1.500 6.9e-05
sonic hedgehog group medulloblastoma 1.500 3.2e-04

Gene RIF (1)

AA Sequence

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQ      1 - 70
IGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES           71 - 134
//

Text Mined References (21)

PMID Year Title