Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 7
Funding $2,325,248.24
PubMed Score 26.34
PubTator Score 10.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 2.109 0.005
astrocytoma -1.700 0.001
ependymoma -1.200 0.046
psoriasis 1.500 0.000
osteosarcoma 1.582 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.001
hereditary spastic paraplegia -1.420 0.006
colon cancer 1.600 0.026
lung cancer 2.900 0.000
Breast cancer 2.700 0.028
adult high grade glioma -1.100 0.000
sonic hedgehog group medulloblastoma 1.500 0.000
nasopharyngeal carcinoma 1.500 0.000

Gene RIF (1)

PMID Text
20552408 PFDN4 inhibition resulted in an increase in cell growth and invasiveness in colorectal cancer cell lines.

AA Sequence

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQ      1 - 70
IGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES           71 - 134
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20552408 2010 Abnormal expression of PFDN4 in colorectal cancer: a novel marker for prognosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17936702 2007 S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling.
More...