Property Summary

NCBI Gene PubMed Count 135
Grant Count 570
R01 Count 254
Funding $155,899,758.68
PubMed Score 3812.68
PubTator Score 1090.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 2.322 0.002
osteosarcoma 1.624 0.000
glioblastoma -1.200 0.025
medulloblastoma, large-cell -1.100 0.001
primary pancreatic ductal adenocarcinoma 1.133 0.011
breast carcinoma -1.100 0.007
ovarian cancer -2.800 0.000
pancreatic cancer 1.200 0.009

Synonym

Accession Q9NQC3 O94962 Q7L7Q5 Q7L7Q6 Q7L7Q8 Q8IUA4 Q96B16 Q9BXG5 Q9H212 Q9H3I3 Q9UQ42 Q9Y293 Q9Y2Y7 Q9Y5U6
Symbols ASY
NSP
NOGO
NOGOC
RTN-X
NOGO-A
NSP-CL
Nogo-B
Nogo-C
RTN4-A
RTN4-C
RTN4-B1
RTN4-B2
NI220/250
Nbla00271
Nbla10545

Gene

PANTHER Protein Class (1)

PDB

2G31   2JV5  

Gene RIF (92)

PMID Text
26656426 Nogo-B expression is down-regulated in intrahepatic cholangiocarcinoma, the implication of which, however, remains to be investigated.
26472601 Data show that the mean peak serum neuroglobin and Nogo-A concentrations were both significantly higher in patients with an unfavorable outcome at 6 months after traumatic brain injury (TBI).
25907690 Epithelial RTN-4B/NOGO-B was downregulated in human and experimental inflammatory bowel disease
25847052 RTN4-C knockdown blocks cell cycle progression and cell growth in colorectal cancer cell lines.
25331889 a novel mechanism that functionally couples cAMP signaling with the proteolytic turnover of NOGO-A, positively impacting on neurite outgrowth in mammalian brain.
25075030 Nogo-A/B expression decreased with increasing squamous cell carcinoma malignancy grade (p=0.026).
25040983 The RTN4 del allele could significantly increase NSCLC risk.
24966913 Identify Nogo-C as a tumor suppressor gene in hepatocellular carcinoma and B-raf as a novel interacting protein.
24626842 the present study found that Nogo-A depletion was capable of inhibiting HCC SMMC-7721 cell proliferation by promoting G2/M cell cycle arrest and apoptosis.
24401759 Neither migration speed, nor cell proliferation, or layer area sizes were influenced by Nogo-A deletion, hence suggesting another role for early postnatal Nogo-A expression in the premigratory zone of the external granule layer.
More...

AA Sequence

MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPT      1 - 70
APAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPP     71 - 140
ARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAENMDLK    141 - 210
EQPGNTISAGQEDFPSVLLETAASLPSLSPLSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKA    211 - 280
KTLLIDRDLTEFSELEYSEMGSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTAL    281 - 350
TKLVKEDEVVSSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKV    351 - 420
DKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIFPLLGDPTSEN    421 - 490
KTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTEEVVANMPEGLTPDLVQEACE    491 - 560
SELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSFEESEATPSPVLPDIVMEAPLNSAVPSAGAS    561 - 630
VIQPSSSPLEASSVNYESIKHEPENPPPYEEAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACD    631 - 700
LIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKES    701 - 770
LTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVY    771 - 840
SNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEIANAPDGAGSL    841 - 910
PCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALATQAEIESIVKPKVLVKEAEKK    911 - 980
LPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSV    981 - 1050
TISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLK   1051 - 1120
FAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRK   1121 - 1190
AE                                                                       1191 - 1192
//

Text Mined References (151)

PMID Year Title
26906412 2016 Transmembrane protein TMEM170A is a newly discovered regulator of ER and nuclear envelope morphogenesis in human cells.
26656426 2016 Down-Regulation of Nogo-B Expression as a Newly Identified Feature of Intrahepatic Cholangiocarcinoma.
26472601 2015 Neuroglobin and Nogo-a as biomarkers for the severity and prognosis of traumatic brain injury.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25907690 2015 A new role for reticulon-4B/NOGO-B in the intestinal epithelial barrier function and inflammatory bowel disease.
25847052 2015 Knockdown of reticulon 4C by lentivirus inhibits human colorectal cancer cell growth.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25331889 2014 Proteolytic control of neurite outgrowth inhibitor NOGO-A by the cAMP/PKA pathway.
More...