Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.16
PubTator Score 1.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -2.700 0.003
ependymoma -3.400 0.000
oligodendroglioma -2.300 0.010
glioblastoma -3.100 0.000
osteosarcoma 2.731 0.001
medulloblastoma -4.000 0.000
cystic fibrosis 1.979 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -3.000 0.000
tuberculosis -2.700 0.001
non-small cell lung cancer 1.064 0.000
adult high grade glioma -3.600 0.000
pilocytic astrocytoma -2.600 0.000
Pick disease -1.200 0.004
acute myeloid leukemia 1.800 0.005
pituitary cancer 1.600 0.000

Synonym

Accession Q9NQ35 Q86WD9
Symbols C11orf14
NY-SAR-105

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19454493 NRIP3 is a novel translocation partner of MLL in acute myeloid leukemia

AA Sequence

MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLME      1 - 70
TNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRL     71 - 140
GLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINL    141 - 210
DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA                                           211 - 241
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19454493 2009 NRIP3: a novel translocation partner of MLL detected in a pediatric acute myeloid leukemia with complex chromosome 11 rearrangements.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.