Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.16
PubTator Score 1.41

Knowledge Summary


No data available


  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia 1.800 5.1e-03
adult high grade glioma -3.600 1.5e-07
astrocytic glioma -2.700 2.8e-03
Astrocytoma, Pilocytic -2.600 1.4e-07
atypical teratoid / rhabdoid tumor -4.200 3.2e-13
cystic fibrosis 1.979 6.3e-06
ependymoma -2.800 1.4e-02
glioblastoma -2.600 1.2e-08
group 3 medulloblastoma -2.800 9.3e-05
malignant mesothelioma 1.100 2.7e-05
medulloblastoma, large-cell -4.600 6.6e-08
non-small cell lung cancer 1.064 1.7e-09
oligodendroglioma -2.300 9.6e-03
osteosarcoma 2.731 1.4e-03
Pick disease -1.200 4.0e-03
pituitary cancer 1.600 4.4e-05
primitive neuroectodermal tumor -3.000 5.4e-05
tuberculosis -2.700 5.5e-04

Gene RIF (1)

AA Sequence

DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA                                           211 - 241

Text Mined References (9)

PMID Year Title