Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.16
PubTator Score 1.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.57525972111722E-18
atypical teratoid / rhabdoid tumor 4369 3.18375369775497E-13
medulloblastoma 1524 6.22402265688807E-10
non-small cell lung cancer 2798 1.68118676191312E-9
medulloblastoma, large-cell 6234 6.64962830229381E-8
adult high grade glioma 2148 1.53988112523785E-7
pilocytic astrocytoma 3086 2.29712056939562E-7
cystic fibrosis 1670 6.30122677187261E-6
glioblastoma 5572 1.91499919949097E-5
malignant mesothelioma 3163 2.68260249698747E-5
pituitary cancer 1972 4.37463077628764E-5
primitive neuroectodermal tumor 3031 5.44074766123457E-5
tuberculosis 1563 5.45013606127683E-4
osteosarcoma 7933 0.0014008117894807
astrocytic glioma 2241 0.00276972078041836
Pick disease 1893 0.00396738979957482
acute myeloid leukemia 785 0.00511945798671548
oligodendroglioma 2849 0.00958862387156181

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -2.700 0.003
ependymoma -3.400 0.000
oligodendroglioma -2.300 0.010
glioblastoma -3.100 0.000
osteosarcoma 2.731 0.001
medulloblastoma -4.000 0.000
cystic fibrosis 1.979 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -3.000 0.000
tuberculosis -2.700 0.001
non-small cell lung cancer 1.064 0.000
adult high grade glioma -3.600 0.000
pilocytic astrocytoma -2.600 0.000
Pick disease -1.200 0.004
acute myeloid leukemia 1.800 0.005
pituitary cancer 1.600 0.000

Synonym

Accession Q9NQ35 Q86WD9
Symbols C11orf14
NY-SAR-105

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
19454493 NRIP3 is a novel translocation partner of MLL in acute myeloid leukemia

AA Sequence

MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLME      1 - 70
TNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRL     71 - 140
GLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINL    141 - 210
DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA                                           211 - 241
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19454493 2009 NRIP3: a novel translocation partner of MLL detected in a pediatric acute myeloid leukemia with complex chromosome 11 rearrangements.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.