Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.75
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.004 1.3e-04
ependymoma 1.200 6.0e-09
group 3 medulloblastoma 1.100 7.2e-04
ovarian cancer -1.500 1.7e-08
subependymal giant cell astrocytoma 1.279 1.7e-02

Gene RIF (2)

AA Sequence

MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGL      1 - 70
VNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVR     71 - 140
LGDPHFYQDSLWLRKEFMQVRR                                                    141 - 162
//

Text Mined References (9)

PMID Year Title