Property Summary

NCBI Gene PubMed Count 27
Grant Count 2
Funding $28,981.4
PubMed Score 83.18
PubTator Score 22.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.098 0.000

Synonym

Accession Q9NPD3
Symbols SKI6
p12A
RRP41
Ski6p
RRP41A
Rrp41p
hRrp41p

Gene

 Grant Application (2)

PDB

2NN6  

Gene RIF (2)

PMID Text
17545563 Knock-down of hRrp41p or hRrp4p but not PM/Scl-100 or PM/Scl-75 leads to codepletion of other subunits.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.

AA Sequence

MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA      1 - 70
LVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN     71 - 140
AATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHL    141 - 210
ERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD                                       211 - 245
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20699273 2010 A link between nuclear RNA surveillance, the human exosome and RNA polymerase II transcriptional termination.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20531386 2010 The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
More...