Property Summary

NCBI Gene PubMed Count 9
PubMed Score 41.47
PubTator Score 14.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25482527 EDI3 links choline metabolism to integrin expression, cell adhesion and spreading
22570503 We have identified EDI3, a key enzyme controlling GPC and choline metabolism; Because inhibition of it corrects the GPC/PC ratio and decreases the migration capacity of tumor cells, it represents a possible target for therapeutic intervention.
22343285 common genetic variants in GPCPD1 are associated with scaling of visual cortical surface area in humans

AA Sequence

MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSRGVSVQYRYFK      1 - 70
GYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVETLDSGWLTCQTEIRLRLHYS     71 - 140
EKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLHKMSNSLEISLISDNEFKCRHSQPECGYGLQ    141 - 210
PDRWTEYSIQTMEPDNLELIFDFFEEDLSEHVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRN    211 - 280
SRKTIGKVRVDYIIIKPLPGYSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAA    281 - 350
SHGAAFVEFDVHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD    351 - 420
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMNLFLDIILKTV    421 - 490
LENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRSRTTPIAMSFAQFENLLGINV    491 - 560
HTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKELGVNGLIYDRIYDWMPEQPNIFQVEQLERL    561 - 630
KQELPELKSCLCPTVSRFVPSSLCGESDIHVDANGIDNVENA                                631 - 672
//

Text Mined References (11)

PMID Year Title
25482527 2014 EDI3 links choline metabolism to integrin expression, cell adhesion and spreading.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22570503 2012 Choline-releasing glycerophosphodiesterase EDI3 drives tumor cell migration and metastasis.
22343285 2012 Association of common genetic variants in GPCPD1 with scaling of visual cortical surface area in humans.
20576599 2010 A novel glycerophosphodiester phosphodiesterase, GDE5, controls skeletal muscle development via a non-enzymatic mechanism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...