Property Summary

NCBI Gene PubMed Count 9
PubMed Score 49.04
PubTator Score 14.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.200 2.6e-03
Alzheimer's disease -1.300 1.9e-02
atypical teratoid / rhabdoid tumor 1.500 7.1e-05
Breast cancer -1.400 1.4e-04
gastric carcinoma 1.200 2.0e-02
glioblastoma 1.300 6.0e-06
group 3 medulloblastoma 1.500 6.9e-03
interstitial cystitis 1.500 3.8e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
invasive ductal carcinoma 1.125 4.6e-03
lung carcinoma -2.200 3.9e-29
non-small cell lung cancer -1.154 9.9e-17
osteosarcoma -1.419 7.7e-04
ovarian cancer 1.400 5.6e-05
pancreatic cancer 1.200 1.2e-02
Pick disease -1.600 8.2e-07
primary pancreatic ductal adenocarcinoma 1.168 1.8e-02
primitive neuroectodermal tumor 1.200 3.3e-04
progressive supranuclear palsy -1.500 8.6e-03
ulcerative colitis 1.100 9.1e-07
X-linked cerebral adrenoleukodystrophy 1.600 1.9e-02

Synonym

Accession Q9NPB8 D3DW06 Q9BQL8 Q9NUX0
Symbols EDI3
GDE5
GDPD6
PREI4

Gene

PDB

2Z0B  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSRGVSVQYRYFK      1 - 70
GYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVETLDSGWLTCQTEIRLRLHYS     71 - 140
EKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLHKMSNSLEISLISDNEFKCRHSQPECGYGLQ    141 - 210
PDRWTEYSIQTMEPDNLELIFDFFEEDLSEHVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRN    211 - 280
SRKTIGKVRVDYIIIKPLPGYSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAA    281 - 350
SHGAAFVEFDVHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD    351 - 420
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMNLFLDIILKTV    421 - 490
LENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRSRTTPIAMSFAQFENLLGINV    491 - 560
HTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKELGVNGLIYDRIYDWMPEQPNIFQVEQLERL    561 - 630
KQELPELKSCLCPTVSRFVPSSLCGESDIHVDANGIDNVENA                                631 - 672
//

Text Mined References (11)

PMID Year Title