Property Summary

NCBI Gene PubMed Count 7
Grant Count 92
R01 Count 61
Funding $7,968,277.02
PubMed Score 7.79
PubTator Score 568.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q9HDD0 D2KX19
Symbols A-C1
HRSL1
HSD28
HRASLS1
H-REV107

Gene

Gene RIF (3)

PMID Text
26503625 The HRASLS (PLA/AT) subfamily of enzymes.
21880860 a possible enzyme activity of A-C1
20837014 The phospholipase active site possesses a structurally conserved Cys-His-His triad as found in NlpC/P60 peptidases, indicating H-REV107 should adopt a similar catalytic mechanism towards phospholipid substrates to that of NlpC/P60 peptidases.

AA Sequence

MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQL      1 - 70
LKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAI     71 - 140
STVEFVTAAVGVFSFLGLFPKGQRAKYY                                              141 - 168
//

Text Mined References (7)

PMID Year Title
26503625 2015 The HRASLS (PLA/AT) subfamily of enzymes.
21880860 2011 Enzymological analysis of the tumor suppressor A-C1 reveals a novel group of phospholipid-metabolizing enzymes.
20837014 2010 Solution structure of the N-terminal catalytic domain of human H-REV107--a novel circular permutated NlpC/P60 domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11474175 2001 Isolation, characterization, and chromosome mapping of a human A-C1 Ha-Ras suppressor gene (HRASLS).
10542256 1999 Molecular cloning and biological activity of a novel Ha-Ras suppressor gene predominantly expressed in skeletal muscle, heart, brain, and bone marrow by differential display using clonal mouse EC cells, ATDC5.
9771974 1998 Transcriptional and translational downregulation of H-REV107, a class II tumour suppressor gene located on human chromosome 11q11-12.