Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.79
PubTator Score 568.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.57971334923644E-26
non-small cell lung cancer 2798 6.47418241755024E-13
acute quadriplegic myopathy 1157 2.06593706744228E-6
malignant mesothelioma 3163 8.57850676193191E-6
Breast cancer 3099 7.61450793647907E-5
pancreatic cancer 2300 0.0010139729422732
pancreatic carcinoma 567 0.0010139729422732
dermatomyositis 967 0.00150333844307026
pilocytic astrocytoma 3086 0.0018536632708741
gastric cancer 436 0.00211891959131259
ovarian cancer 8492 0.00281923029127836
non primary Sjogren syndrome sicca 840 0.00495103712493301
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00816396024184626
psoriasis 6685 0.0117844614264636
cutaneous lupus erythematosus 1056 0.0132870545197637
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0149732414342226
adrenocortical carcinoma 1427 0.0201471775109982
esophageal adenocarcinoma 737 0.0224583885822045
oligodendroglioma 2849 0.0354577506894668
ependymoma 2514 0.046312101841691
colon cancer 1475 0.0499473305949176

Expression

  Differential Expression (21)

Synonym

Accession Q9HDD0 D2KX19
Symbols A-C1
HRSL1
HSD28
HRASLS1
H-REV107

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (3)

PMID Text
26503625 The HRASLS (PLA/AT) subfamily of enzymes.
21880860 a possible enzyme activity of A-C1
20837014 The phospholipase active site possesses a structurally conserved Cys-His-His triad as found in NlpC/P60 peptidases, indicating H-REV107 should adopt a similar catalytic mechanism towards phospholipid substrates to that of NlpC/P60 peptidases.

AA Sequence

MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQL      1 - 70
LKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAI     71 - 140
STVEFVTAAVGVFSFLGLFPKGQRAKYY                                              141 - 168
//

Text Mined References (7)

PMID Year Title
26503625 2015 The HRASLS (PLA/AT) subfamily of enzymes.
21880860 2011 Enzymological analysis of the tumor suppressor A-C1 reveals a novel group of phospholipid-metabolizing enzymes.
20837014 2010 Solution structure of the N-terminal catalytic domain of human H-REV107--a novel circular permutated NlpC/P60 domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11474175 2001 Isolation, characterization, and chromosome mapping of a human A-C1 Ha-Ras suppressor gene (HRASLS).
10542256 1999 Molecular cloning and biological activity of a novel Ha-Ras suppressor gene predominantly expressed in skeletal muscle, heart, brain, and bone marrow by differential display using clonal mouse EC cells, ATDC5.
9771974 1998 Transcriptional and translational downregulation of H-REV107, a class II tumour suppressor gene located on human chromosome 11q11-12.