Knowledge Summary


No data available

AA Sequence

VKLQLAFTAYKYVDICFPEQMAYSRYIRWYIH                                           71 - 102

Text Mined References (1)

PMID Year Title