Knowledge Summary

Patent

No data available

AA Sequence

MANTQLDHLHYTTEFTRNDLLIICKKFNLMLMDEDIISLLAIFIKMCLWLWKQFLKRGSKCSETSELLEK      1 - 70
VKLQLAFTAYKYVDICFPEQMAYSRYIRWYIH                                           71 - 102
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.