Property Summary

NCBI Gene PubMed Count 19
Grant Count 10
R01 Count 5
Funding $399,112.91
PubMed Score 12.20
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.875 0.000
diabetes mellitus -1.200 0.002

Gene RIF (6)

PMID Text
26228655 Study identifies XAB2 tagSNPs (rs794078 and rs4134816) significantly associated with the risk of non-small cell lung cancer (NSCLC) in Chinese population, which supports XAB2 playing significant role in the development of NSCLC.
25671812 Results of protein-protein interaction between human Dbr1 and factors found in the Intron Large complex identify Xab2 and a novel protein CWF19L1 as specific interactors of DBR1.
25027282 Hematopoietic myeloid cell differentiation diminishes nucleotide excision repair and XAB2 expression.
20522537 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of XPA binding protein 2 (XAB2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17981804 XAB2 complex is a multifunctional factor involved in pre-mRNA splicing, transcription, and transcription-coupled DNA repair.

AA Sequence

MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKL      1 - 70
WYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRAL     71 - 140
PITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFV    141 - 210
SKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYE    211 - 280
EAIRTVMTVRDFTQVFDSYAQFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLL    281 - 350
RQNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEK    351 - 420
ATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRVYKSLKVWSML    421 - 490
ADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKAYERGISLFKWPNVSDIWSTY    491 - 560
LTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYD    561 - 630
MFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTT    631 - 700
GAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMK    701 - 770
LLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLE    771 - 840
QQSVPAAVFGSLKED                                                           841 - 855
//

Text Mined References (24)

PMID Year Title
26228655 2015 XAB2 tagSNPs contribute to non-small cell lung cancer susceptibility in Chinese population.
25671812 2015 Identification of the specific interactors of the human lariat RNA debranching enzyme 1 protein.
25416956 2014 A proteome-scale map of the human interactome network.
25027282 2014 Hematopoietic myeloid cell differentiation diminishes nucleotide excision repair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...