Property Summary

NCBI Gene PubMed Count 11
PubMed Score 62.63
PubTator Score 117.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pain agnosia 104 4.23 2.1

Gene RIF (2)

AA Sequence

MEIISSKLFILLTLATSSLLTSNIFCADELVISNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNV      1 - 70
IKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSV     71 - 140
CRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK                  141 - 196
//

Text Mined References (11)

PMID Year Title