Property Summary

NCBI Gene PubMed Count 11
Grant Count 8
R01 Count 5
Funding $353,251
PubMed Score 57.13
PubTator Score 117.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pain agnosia 99 4.099 2.0

Gene RIF (2)

PMID Text
25180599 RFRP-3/GPR147 may play secondary, modulatory roles on the regulation of pubertal development; a restraining modulatory effect of the NPVF p.I71_K72 variant on the activation of the gonadotrophic axis cannot be ruled out
20027225 GnIH homologs in the human hypothalamus and were identified and human GnIH receptor (GPR147) mRNA expression in the hypothalamus as well as in the pituitary, was characterized.

AA Sequence

MEIISSKLFILLTLATSSLLTSNIFCADELVISNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNV      1 - 70
IKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSV     71 - 140
CRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK                  141 - 196
//

Text Mined References (11)

PMID Year Title
25180599 2014 Mutational analysis of the genes encoding RFamide-related peptide-3, the human orthologue of gonadotrophin-inhibitory hormone, and its receptor (GPR147) in patients with gonadotrophin-releasing hormone-dependent pubertal disorders.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
20027225 2009 Identification of human GnIH homologs, RFRP-1 and RFRP-3, and the cognate receptor, GPR147 in the human hypothalamic pituitary axis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
11951088 2002 Genomic structure and assessment of the retinally expressed RFamide-related peptide gene in dominant cystoid macular dystrophy.
11481330 2001 Identification and characterization of novel mammalian neuropeptide FF-like peptides that attenuate morphine-induced antinociception.
11173868 2000 EST mining of the UniGene dataset to identify retina-specific genes.
11025660 2000 New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals.
More...