Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.56
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.600 0.042
glioblastoma -2.300 0.000
oligodendroglioma -1.300 0.000
ependymoma -1.500 0.008
group 3 medulloblastoma -3.500 0.000
atypical teratoid/rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.700 0.001
primitive neuroectodermal tumor -2.800 0.000
Atopic dermatitis -1.400 0.007
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -3.100 0.000
subependymal giant cell astrocytoma -2.456 0.044
progressive supranuclear palsy -1.400 0.027
psoriasis -2.300 0.000

Synonym

Accession Q9HCP6 Q8TBG3 Q9ULP7
Symbols GUP1
OACT3
C3orf3
MBOAT3
MSTP002

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
20646595 KIAA1173 gene is highly expressed in normal skin, but it becomes down-regulated in skin squamous cell carcinoma.

AA Sequence

MGIKTALPAAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYIGRKMDVADFEWVMWFT      1 - 70
SFRNVIIFALSGHVLFAKLCTMVAPKLRSWMYAVYGALAVMGTMGPWYLLLLLGHCVGLYVASLLGQPWL     71 - 140
CLGLGLASLASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKY    141 - 210
NFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQAGLSVVAIMAVDIFFHFFYILTIPSDLKFA    211 - 280
NRLPDSALAGLAYSNLVYDWVKAAVLFGVVNTVACLDHLDPPQPPKCITALYVFAETHFDRGINDWLCKY    281 - 350
VYNHIGGEHSAVIPELAATVATFAITTLWLGPCDIVYLWSFLNCFGLNFELWMQKLAEWGPLARIEASLS    351 - 420
VQMSRRVRALFGAMNFWAIIMYNLVSLNSLKFTELVARRLLLTGFPQTTLSILFVTYCGVQLVKERERTL    421 - 490
ALEEEQKQDKEKPE                                                            491 - 504
//

Text Mined References (5)

PMID Year Title
20646595 2010 [Expression, clinical and pathological significance of KIAA1173 gene in skin squamous cell carcinoma].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11374908 2001 Isolation of novel heart-specific genes using the BodyMap database.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.