Property Summary

NCBI Gene PubMed Count 6
PubMed Score 21.79
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
breast carcinoma 1.100 1.3e-15
ductal carcinoma in situ 2.400 1.3e-03
group 3 medulloblastoma 1.100 7.2e-03
interstitial cystitis -1.500 2.9e-03
interstitial lung disease -1.100 5.2e-03
invasive ductal carcinoma -1.100 2.9e-02
lung adenocarcinoma -1.400 1.3e-14
lung cancer -1.200 2.0e-04
non-small cell lung cancer -2.074 1.3e-29
ovarian cancer -1.500 4.5e-06
pancreatic ductal adenocarcinoma liver m... -1.870 1.1e-03
pituitary cancer 1.400 2.3e-05
psoriasis -2.300 8.8e-05
spina bifida -2.465 4.0e-02
urothelial carcinoma -1.200 3.2e-02

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLPKKAKGQELFD      1 - 70
QIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFV     71 - 140
LQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYRG    141 - 210
QTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNK    211 - 280
LTLVVVEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGK    281 - 350
TEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS    351 - 420
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQALNDVNVATRLP    421 - 490
GLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLTEKCLNNVIESPGLNVMRVPP    491 - 560
DFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAVLNENNVPLPKESLETLMLITPADSGSVLKE    561 - 630
ATDELDALLASLTENLIDHTVAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLIS    631 - 700
PPAPFLVDAVTSSGPILAEEAVLKQKCLLTTEL                                         701 - 733
//

Text Mined References (12)

PMID Year Title