Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $375,291.25
PubMed Score 20.57
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
interstitial lung disease -1.700 0.003
urothelial carcinoma -1.200 0.032
psoriasis -2.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.870 0.001
non-small cell lung cancer -2.074 0.000
lung cancer -1.200 0.000
interstitial cystitis -2.000 0.000
lung adenocarcinoma -1.400 0.000
group 3 medulloblastoma 1.100 0.007
breast carcinoma 1.100 0.000
spina bifida -2.465 0.040
ductal carcinoma in situ 2.400 0.001
invasive ductal carcinoma 2.500 0.010
ovarian cancer 1.800 0.000
pituitary cancer 1.400 0.000

Synonym

Accession Q9HCM4 Q7Z5S1 Q8IZ12 Q9H975
Symbols YRT
BE37
YMO1

Gene

Gene RIF (1)

PMID Text
17920587 the importance of a conserved Crumbs-MPP5-EPB41L5 polarity complex in mammals for separation of the apical and basolateral domains through specialized cell-cell junctions

AA Sequence

MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLPKKAKGQELFD      1 - 70
QIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFV     71 - 140
LQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELAIFEKWKEYRG    141 - 210
QTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNK    211 - 280
LTLVVVEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGK    281 - 350
TEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS    351 - 420
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQALNDVNVATRLP    421 - 490
GLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLTEKCLNNVIESPGLNVMRVPP    491 - 560
DFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAVLNENNVPLPKESLETLMLITPADSGSVLKE    561 - 630
ATDELDALLASLTENLIDHTVAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLIS    631 - 700
PPAPFLVDAVTSSGPILAEEAVLKQKCLLTTEL                                         701 - 733
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17920587 2007 FERM protein EPB41L5 is a novel member of the mammalian CRB-MPP5 polarity complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...