Property Summary

NCBI Gene PubMed Count 28
Grant Count 12
R01 Count 8
Funding $620,793.18
PubMed Score 24.74
PubTator Score 10.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.637 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.500 0.014
medulloblastoma, large-cell -1.600 0.020
breast carcinoma -1.800 0.000
adult high grade glioma -1.200 0.005
pilocytic astrocytoma -1.800 0.000
posterior fossa group B ependymoma 1.300 0.000
ductal carcinoma in situ -1.200 0.002
invasive ductal carcinoma -1.300 0.005
ovarian cancer -1.500 0.000

Gene RIF (8)

PMID Text
25518740 Data indicate that plexin A1-4 (PLXNA1-4) mediation of neuroanatomical traits can be detected using in vivo neuroimaging techniques.
25043464 There is a significant association between Alzheimer's disease risk and SNPs in PLXNA4.
24244438 Rare variants in PLXNA4 and Parkinson's disease.
21832283 Plexin-A4 promotes tumor progression and tumor angiogenesis by enhancement of VEGF and bFGF signaling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERTGHIYLGAVNR      1 - 70
IYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKENRLIACGSLYQGICKL     71 - 140
LRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEA    141 - 210
DGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKL    211 - 280
VRLCKEDTAFNSYVEVPIGCERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSL    281 - 350
DESALCIFILKQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR    351 - 420
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKD    421 - 490
HEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKERCERSKEPRRFASEMKQCVR    491 - 560
LTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQCYSPAAKEVPRIITENGDH    561 - 630
HVVQLQLKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPED    631 - 700
CPQLLRVDKILVPVEVIKPITLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYE    701 - 770
GMEINNLPVELTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA    771 - 840
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPLVDGYIP    841 - 910
AEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTITGTNLN    911 - 980
AGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWS    981 - 1050
IVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGF   1051 - 1120
ILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPC   1121 - 1190
TVTVSDVQLLCESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY   1191 - 1260
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIE   1261 - 1330
DHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEY   1331 - 1400
ATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQME   1401 - 1470
KGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNV   1471 - 1540
PCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNN   1541 - 1610
STVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR   1611 - 1680
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVN   1681 - 1750
MIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGK   1751 - 1820
MPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQCGKQKLAYKLEQVITLM   1821 - 1890
SLDS                                                                     1891 - 1894
//

Publication (31)

PMID Year Title
25518740 2015 PlexinA polymorphisms mediate the developmental trajectory of human corpus callosum microstructure.
25043464 2014 PLXNA4 is associated with Alzheimer disease and modulates tau phosphorylation.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24244438 2013 Rare variants in PLXNA4 and Parkinson's disease.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23593239 2013 The molecular genetic architecture of self-employment.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22566634 2012 The genetic architecture of economic and political preferences.
More...