Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.03
PubTator Score 22.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.046 2.6e-05
cutaneous lupus erythematosus -1.100 2.9e-03
group 3 medulloblastoma 1.400 2.1e-02
hereditary spastic paraplegia -1.012 2.4e-02
intraductal papillary-mucinous adenoma (... 1.100 3.0e-04
intraductal papillary-mucinous carcinoma... 1.100 3.4e-02
juvenile dermatomyositis 1.098 3.1e-07
osteosarcoma -2.930 5.9e-08
ovarian cancer -1.400 1.0e-04
psoriasis -1.900 2.9e-04

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVR      1 - 70
HFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGH     71 - 140
LNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVS    141 - 210
ATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPAS    211 - 280
HQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ    281 - 350
TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVA    351 - 420
TPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGA    421 - 490
DSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKIN    491 - 560
AKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEI    561 - 630
SQELLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDY    631 - 700
RPGITYIVVQKRHHTRLFCADKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYQVL    701 - 770
WDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRD    771 - 840
PQALAKAVQIHHDTQHTMYFA                                                     841 - 861
//

Text Mined References (32)

PMID Year Title