Property Summary

NCBI Gene PubMed Count 19
Grant Count 10
R01 Count 6
Funding $1,952,458
PubMed Score 21.81
PubTator Score 22.67

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23748378 Chimeras with Ago4 N-terminal domains were defective in RISC activation & sometimes also in RNA loading. This highlights the pleiotropic role of the Ago N domain & emphasizes the unique position of human Ago4 within the Ago protein family.
20146808 EIF2C2-4 and PIWIL4 appear increased in advanced tumors with distant metastasis, suggesting they may promote tumor invasion
19393748 EIF2C4 protein is expressed in differentiating and terminally differentiated N-type cells more than in S- and I-type cells
18771919 The specificity of RNA interference depends on the concentration of Ago1, Ago3, and Ago4 relative to Ago2.

AA Sequence

MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVR      1 - 70
HFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGH     71 - 140
LNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVS    141 - 210
ATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPAS    211 - 280
HQTFPLQLENGQAMECTVAQYFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ    281 - 350
TSTMIKATARSAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRVLPAPMLQYGGRNKTVA    351 - 420
TPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGA    421 - 490
DSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKIN    491 - 560
AKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQEI    561 - 630
SQELLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDY    631 - 700
RPGITYIVVQKRHHTRLFCADKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYQVL    701 - 770
WDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRD    771 - 840
PQALAKAVQIHHDTQHTMYFA                                                     841 - 861
//

Text Mined References (24)

PMID Year Title
23748378 2013 Molecular dissection of human Argonaute proteins by DNA shuffling.
22795694 2012 Slicing-independent RISC activation requires the argonaute PAZ domain.
20146808 2010 Argonaute proteins: potential biomarkers for human colon cancer.
19966796 2010 ATP-dependent human RISC assembly pathways.
19946888 2010 Defining the membrane proteome of NK cells.
19393748 2009 Differential expression of Dicer and Argonaute genes during the differentiation of human neuroblastoma cells.
19383768 2009 The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.
19324964 2009 The C-terminal half of human Ago2 binds to multiple GW-rich regions of GW182 and requires GW182 to mediate silencing.
19167051 2009 Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.
18771919 2008 Importance of translation and nonnucleolytic ago proteins for on-target RNA interference.
More...