Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.61
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Dental pulp necrosis 10 3.506 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... 1.301 5.4e-03
group 3 medulloblastoma 1.400 4.9e-03
juvenile dermatomyositis 1.090 3.7e-11
osteosarcoma 1.244 6.1e-05
ovarian cancer -1.800 3.6e-10
Pick disease 1.300 3.4e-06

Gene RIF (5)

AA Sequence

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG      1 - 70
ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA     71 - 140
DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC    141 - 210
WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV    211 - 280
FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD    281 - 350
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG    351 - 420
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR                                      421 - 456
//

Text Mined References (22)

PMID Year Title