Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.61
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Dental pulp necrosis 10 3.506 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... 1.301 5.4e-03
group 3 medulloblastoma 1.400 4.9e-03
juvenile dermatomyositis 1.090 3.7e-11
osteosarcoma 1.244 6.1e-05
ovarian cancer -1.800 3.6e-10
Pick disease 1.300 3.4e-06

Synonym

Accession Q9HCE5 A6NIG1 Q969V2
Symbols hMETTL14

Gene

PANTHER Protein Class (1)

PDB

5IL0   5IL1   5IL2   5K7M   5K7U   5K7W   5L6D   5L6E   5TEY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG      1 - 70
ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA     71 - 140
DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC    141 - 210
WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV    211 - 280
FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD    281 - 350
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG    351 - 420
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR                                      421 - 456
//

Text Mined References (22)

PMID Year Title