Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.98
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.244 0.000
juvenile dermatomyositis 1.090 0.000
group 3 medulloblastoma 1.400 0.005
Pick disease 1.300 0.000
ovarian cancer -1.800 0.000
cystic fibrosis and chronic rhinosinusit... 1.301 0.005

Synonym

Accession Q9HCE5 A6NIG1 Q969V2
Symbols hMETTL14

Gene

PANTHER Protein Class (1)

PDB

5IL0   5IL1   5IL2   5K7M   5K7U   5K7W  

Gene RIF (3)

PMID Text
27281194 Structure of the METTL3-METTL14 complex
24316715 methyltransferase-like protein 14 in a complex with METTL3 mediates nuclear RNA methylation
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG      1 - 70
ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA     71 - 140
DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC    141 - 210
WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV    211 - 280
FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD    281 - 350
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG    351 - 420
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR                                      421 - 456
//

Text Mined References (18)

PMID Year Title
27373337 2016 Structural Basis for Cooperative Function of Mettl3 and Mettl14 Methyltransferases.
27281194 2016 Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex.
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
25719671 2015 N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
25231264 2014 Affinity proteomic profiling of plasma, cerebrospinal fluid, and brain tissue within multiple sclerosis.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
24407421 2014 Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.
24316715 2014 A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
More...