Property Summary

NCBI Gene PubMed Count 39
Grant Count 36
R01 Count 9
Funding $2,495,889.26
PubMed Score 33.77
PubTator Score 29.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 0.005
ependymoma 1.500 0.000
glioblastoma 1.600 0.000
osteosarcoma 1.107 0.003
atypical teratoid / rhabdoid tumor 1.700 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.500 0.000
ovarian cancer 1.400 0.000

Gene RIF (37)

PMID Text
26842467 MOV10 acts as an anti-influenza virus factor through specifically inhibiting the nuclear transportation of nucleoprotein and subsequently inhibiting the function of the viral ribonucleoprotein complex
26379090 The DEAG-box of huamn MOV10 was required for the enhancement of Rev/RRE-dependent nuclear export.
26379090 HIV-1 Rev requires MOV10 helicase activity for enhanced function
26379090 HIV-1 Rev requires MOV10 helicase activity for enhanced function
26379090 HIV-1 Rev requires MOV10 helicase activity for enhanced function
26379090 HIV-1 Rev requires MOV10 helicase activity for enhanced function
26379090 siRNA-mediated knockdown of endogeneous MOV10 impairs HIV-1 virus production and Gag expression in 293T cells
25533532 The endogenous Mov10 could promote hepatitis B virus replication in vitro.
25464849 A dual function for MOV10 in regulating translation: it facilitates microRNA-mediated translation of some RNAs, but it also increases expression of other RNAs by preventing AGO2 function.
25010285 HIV-1 Rev requires MOV10 helicase activity for enhanced function
More...

AA Sequence

MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVT      1 - 70
KTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLL     71 - 140
IRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYF    141 - 210
PATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRA    211 - 280
KGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQ    281 - 350
MEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKV    351 - 420
ELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKL    421 - 490
KLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGA    491 - 560
DLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLV    561 - 630
SAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGY    631 - 700
SLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLP    701 - 770
RQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKI    771 - 840
RYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVT    841 - 910
RAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDY    911 - 980
LPQEREGEGGLSLQVEPEWRNEL                                                   981 - 1003
//

Text Mined References (48)

PMID Year Title
26842467 2016 Host Protein Moloney Leukemia Virus 10 (MOV10) Acts as a Restriction Factor of Influenza A Virus by Inhibiting the Nuclear Import of the Viral Nucleoprotein.
26379090 2015 RNA helicase MOV10 functions as a co-factor of HIV-1 Rev to facilitate Rev/RRE-dependent nuclear export of viral mRNAs.
25533532 2015 The role of Moloney leukemia virus 10 in hepatitis B virus expression in hepatoma cells.
25464849 2014 MOV10 and FMRP regulate AGO2 association with microRNA recognition elements.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24726324 2014 MOV10 Is a 5' to 3' RNA helicase contributing to UPF1 mRNA target degradation by translocation along 3' UTRs.
24338417 2013 Genetic variations in MOV10 and CACNB2 are associated with hypertension in a Chinese Han population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23926332 2013 Mov10 and APOBEC3G localization to processing bodies is not required for virion incorporation and antiviral activity.
23754279 2013 The MOV10 helicase inhibits LINE-1 mobility.
More...