Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.98
PubTator Score 11.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer 1.200 0.002
pancreatic cancer 1.800 0.001
oligodendroglioma 1.500 0.021
esophageal adenocarcinoma -2.400 0.018
osteosarcoma -3.076 0.000
ependymoma -1.900 0.000
glioblastoma -1.400 0.032
group 4 medulloblastoma -2.000 0.000
atypical teratoid/rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.700 0.000
primary pancreatic ductal adenocarcinoma 1.776 0.001
lung cancer -2.400 0.000
active Crohn's disease 1.289 0.006
pediatric high grade glioma -1.300 0.015
pancreatic carcinoma 1.800 0.001
aldosterone-producing adenoma 2.172 0.015
lung adenocarcinoma -1.700 0.000
Breast cancer 2.800 0.012
lung carcinoma -1.300 0.000
ductal carcinoma in situ -1.300 0.026
ovarian cancer 1.500 0.023
pituitary cancer 1.600 0.002
dermatomyositis 1.100 0.001

Synonym

Accession Q9HC58 B1AKV7 Q9BQJ9 Q9BQL7 Q9BQY3 Q9H519
Symbols NCKX3

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
21321244 NCKX3 is abundantly expressed within the human endometrium at the transcriptional and translational levels, and its level is regulated by steroid hormones (particularly estradiol) during the human menstrual cycle.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11294880 Plasma membrane ion transporter.Displayed K(+)-dependent Na(+)/Ca(2+) exchanger activity when assayed in heterologous expression systems, using digital imaging of fura-2 fluorescence, electrophysiology, or radioactive (45)Ca(2+) uptake.

AA Sequence

MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRKWMMARKLMQV      1 - 70
NDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKIC     71 - 140
ERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSS    141 - 210
WCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLA    211 - 280
NNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRM    281 - 350
LINERQRLINSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNEN    351 - 420
DEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAF    421 - 490
SYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLP    491 - 560
WALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEF    561 - 630
NVFTFVNLPMCGDH                                                            631 - 644
//

Text Mined References (8)

PMID Year Title
24132900 2013 Genome-wide association study of atypical psychosis.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21321244 2011 Distinct expression of the calcium exchangers, NCKX3 and NCX1, and their regulation by steroid in the human endometrium during the menstrual cycle.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20031604 2009 Genome-wide association scan identifies variants near Matrix Metalloproteinase (MMP) genes on chromosome 11q21-22 strongly associated with serum MMP-1 levels.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11294880 2001 Molecular cloning of a third member of the potassium-dependent sodium-calcium exchanger gene family, NCKX3.