Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.02
PubTator Score 11.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.289 6.4e-03
adult high grade glioma -1.300 8.3e-03
aldosterone-producing adenoma 2.172 1.5e-02
atypical teratoid / rhabdoid tumor -3.100 2.1e-07
Breast cancer 2.800 1.2e-02
dermatomyositis 1.100 1.2e-03
ductal carcinoma in situ -1.100 2.1e-02
ependymoma -1.900 2.5e-06
esophageal adenocarcinoma -2.400 1.8e-02
gastric cancer 1.200 2.0e-03
glioblastoma -1.200 5.7e-03
group 3 medulloblastoma -1.600 2.3e-02
lung adenocarcinoma -1.700 1.2e-10
lung cancer -1.200 1.7e-02
lung carcinoma -1.300 8.2e-17
medulloblastoma, large-cell -3.700 2.8e-07
oligodendroglioma 1.300 3.1e-02
osteosarcoma -2.999 2.7e-04
ovarian cancer -1.100 7.3e-04
pancreatic cancer 1.800 5.7e-04
pancreatic carcinoma 1.800 5.7e-04
pituitary cancer 1.600 1.9e-03
primary pancreatic ductal adenocarcinoma 1.776 5.3e-04

Gene RIF (3)

AA Sequence

MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRKWMMARKLMQV      1 - 70
NDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKIC     71 - 140
ERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSS    141 - 210
WCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLA    211 - 280
NNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRM    281 - 350
LINERQRLINSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNEN    351 - 420
DEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAF    421 - 490
SYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLP    491 - 560
WALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEF    561 - 630
NVFTFVNLPMCGDH                                                            631 - 644
//

Text Mined References (8)

PMID Year Title