Property Summary

NCBI Gene PubMed Count 24
PubMed Score 194.48
PubTator Score 56.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.409 2.5e-06
group 4 medulloblastoma -1.200 4.2e-05
inflammatory breast cancer 1.200 1.2e-03
tuberculosis -1.100 7.1e-07

Gene RIF (11)

AA Sequence

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQIL      1 - 70
QEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVD     71 - 140
VLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAE    141 - 210
GKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALG    211 - 280
FFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR                                  281 - 320
//

Text Mined References (27)

PMID Year Title